BLASTX nr result
ID: Forsythia23_contig00038053
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00038053 (364 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002529253.1| conserved hypothetical protein [Ricinus comm... 58 3e-06 >ref|XP_002529253.1| conserved hypothetical protein [Ricinus communis] gi|223531289|gb|EEF33131.1| conserved hypothetical protein [Ricinus communis] Length = 2057 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/50 (58%), Positives = 34/50 (68%) Frame = -3 Query: 167 EKGSPWRNLQLILFLQNTNIDLLKKVDLASSYVNSVTNETADDIGQRPET 18 E PWRNLQLIL LQN IDL KKV+LA SYVN E A+++ + ET Sbjct: 60 EAAHPWRNLQLILSLQNKEIDLQKKVELAFSYVNLRATEEANEVEEEEET 109