BLASTX nr result
ID: Forsythia23_contig00037459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00037459 (304 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075337.1| PREDICTED: thioredoxin reductase NTRC [Sesam... 65 1e-08 >ref|XP_011075337.1| PREDICTED: thioredoxin reductase NTRC [Sesamum indicum] Length = 555 Score = 65.5 bits (158), Expect = 1e-08 Identities = 37/79 (46%), Positives = 51/79 (64%), Gaps = 1/79 (1%) Frame = -3 Query: 236 IGFGAGIGIRVRFAGHSTHRATFAMATPSTISNAILPARNNLVFVKGGQIRRHSVRFD-S 60 +G GA IG F T A +MATPST+SN +LP+RNNL+F+K G RR ++ F S Sbjct: 15 LGAGAEIGNGAGFGAPPTS-ALSSMATPSTLSNTLLPSRNNLLFLKPGLTRRRTIPFQAS 73 Query: 59 VGATRLTHHRLFSPSFRVS 3 +TRL+H R+ +FRV+ Sbjct: 74 AFSTRLSHRRVIGSAFRVA 92