BLASTX nr result
ID: Forsythia23_contig00037369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00037369 (416 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP03843.1| unnamed protein product [Coffea canephora] 68 2e-09 ref|XP_004232161.1| PREDICTED: probable sugar phosphate/phosphat... 56 8e-06 >emb|CDP03843.1| unnamed protein product [Coffea canephora] Length = 382 Score = 68.2 bits (165), Expect = 2e-09 Identities = 35/58 (60%), Positives = 43/58 (74%), Gaps = 3/58 (5%) Frame = -1 Query: 383 QRFKMEKK*SDLYVPDDIINKSP---VGINGRNDLNVDEEAAILTSIRVSHLGRSQHS 219 + FKMEKK SDLYVPDD IN S +G N +D+NVDEEA +L S R+SHLG+S +S Sbjct: 321 KEFKMEKKSSDLYVPDDTINSSSGLRIGRNSASDVNVDEEAPLLASSRLSHLGQSHYS 378 >ref|XP_004232161.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g17430 [Solanum lycopersicum] gi|723671077|ref|XP_010316218.1| PREDICTED: probable sugar phosphate/phosphate translocator At3g17430 [Solanum lycopersicum] Length = 381 Score = 56.2 bits (134), Expect = 8e-06 Identities = 32/54 (59%), Positives = 35/54 (64%), Gaps = 2/54 (3%) Frame = -1 Query: 383 QRFKMEKK*SDLYVPDDIINKS--PVGINGRNDLNVDEEAAILTSIRVSHLGRS 228 + KMEKK SDLYVPDDI+ S NG D VDEEA + S RVSHLGRS Sbjct: 321 KELKMEKKSSDLYVPDDIVKNSGGKGSRNGSPDSMVDEEAPFIPSSRVSHLGRS 374