BLASTX nr result
ID: Forsythia23_contig00037263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00037263 (406 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090311.1| PREDICTED: protein YLS9-like [Sesamum indicum] 58 2e-06 ref|XP_012838512.1| PREDICTED: protein YLS9-like [Erythranthe gu... 58 2e-06 >ref|XP_011090311.1| PREDICTED: protein YLS9-like [Sesamum indicum] Length = 257 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/57 (56%), Positives = 34/57 (59%) Frame = -1 Query: 172 DPELVRRATCLRRIFAXXXXXXXXXXXXXXXXXXXLRPQLPEFRVDSFSFSNFSITN 2 D + VRRATCLRRIFA LRPQLPEFRVDSFS SNFS+ N Sbjct: 60 DADSVRRATCLRRIFAFVIGLVVIFGTITFIVWLVLRPQLPEFRVDSFSMSNFSLGN 116 >ref|XP_012838512.1| PREDICTED: protein YLS9-like [Erythranthe guttatus] gi|604331179|gb|EYU36037.1| hypothetical protein MIMGU_mgv1a017876mg [Erythranthe guttata] Length = 259 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/57 (56%), Positives = 34/57 (59%) Frame = -1 Query: 172 DPELVRRATCLRRIFAXXXXXXXXXXXXXXXXXXXLRPQLPEFRVDSFSFSNFSITN 2 D E VRRATCLRRIFA LRPQLPEFRVDSFS SNF++ N Sbjct: 62 DQESVRRATCLRRIFAFVIGLVVIFGTITFIVWLVLRPQLPEFRVDSFSISNFTLGN 118