BLASTX nr result
ID: Forsythia23_contig00036245
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00036245 (519 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007678743.1| hypothetical protein BAUCODRAFT_58696, parti... 57 5e-06 >ref|XP_007678743.1| hypothetical protein BAUCODRAFT_58696, partial [Baudoinia compniacensis UAMH 10762] gi|449297759|gb|EMC93776.1| hypothetical protein BAUCODRAFT_58696, partial [Baudoinia compniacensis UAMH 10762] Length = 51 Score = 57.0 bits (136), Expect = 5e-06 Identities = 25/38 (65%), Positives = 31/38 (81%) Frame = -2 Query: 494 AASHFPQNFDLNRPDQAMSSYQKQMHLHTQKQFENATA 381 A HF Q FDL+RP+QAMSSYQ+ MH HT++QFE AT+ Sbjct: 8 AQDHFAQTFDLSRPEQAMSSYQRLMHQHTKQQFEMATS 45