BLASTX nr result
ID: Forsythia23_contig00036241
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00036241 (341 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008461281.1| PREDICTED: U6 snRNA-associated Sm-like prote... 110 3e-22 ref|XP_010691554.1| PREDICTED: U6 snRNA-associated Sm-like prote... 110 4e-22 ref|XP_010038129.1| PREDICTED: U6 snRNA-associated Sm-like prote... 110 4e-22 ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao] ... 110 4e-22 ref|XP_006444137.1| hypothetical protein CICLE_v10023059mg [Citr... 109 6e-22 ref|XP_010091130.1| hypothetical protein L484_011338 [Morus nota... 109 8e-22 ref|XP_010278777.1| PREDICTED: U6 snRNA-associated Sm-like prote... 109 8e-22 ref|XP_004493646.1| PREDICTED: sm-like protein LSM2 [Cicer ariet... 109 8e-22 ref|XP_004294156.1| PREDICTED: sm-like protein LSM2 [Fragaria ve... 109 8e-22 ref|XP_004135926.1| PREDICTED: sm-like protein LSM2 [Cucumis sat... 109 8e-22 ref|XP_010652110.1| PREDICTED: U6 snRNA-associated Sm-like prote... 108 1e-21 ref|XP_008458018.1| PREDICTED: U6 snRNA-associated Sm-like prote... 108 1e-21 emb|CBI32330.3| unnamed protein product [Vitis vinifera] 108 1e-21 ref|XP_003625831.1| SnRNP core Sm protein Sm-X5-like protein [Me... 108 1e-21 ref|XP_007162394.1| hypothetical protein PHAVU_001G148500g [Phas... 108 1e-21 gb|EPS69310.1| hypothetical protein M569_05456 [Genlisea aurea] 108 1e-21 ref|XP_010909268.1| PREDICTED: U6 snRNA-associated Sm-like prote... 108 1e-21 ref|XP_008372267.1| PREDICTED: U6 snRNA-associated Sm-like prote... 108 1e-21 ref|XP_002304049.1| small nuclear ribonucleoprotein D [Populus t... 108 2e-21 gb|ABK93861.1| unknown [Populus trichocarpa] 108 2e-21 >ref|XP_008461281.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Cucumis melo] Length = 93 Score = 110 bits (276), Expect = 3e-22 Identities = 52/53 (98%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 93 >ref|XP_010691554.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Beta vulgaris subsp. vulgaris] gi|870867538|gb|KMT18407.1| hypothetical protein BVRB_2g025560 [Beta vulgaris subsp. vulgaris] Length = 93 Score = 110 bits (275), Expect = 4e-22 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 93 >ref|XP_010038129.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Eucalyptus grandis] gi|823148095|ref|XP_012473956.1| PREDICTED: sm-like protein LSM2 [Gossypium raimondii] gi|629083496|gb|KCW49941.1| hypothetical protein EUGRSUZ_K03403 [Eucalyptus grandis] gi|728827574|gb|KHG07251.1| U6 snRNA-associated Sm-like protein LSm2 [Gossypium arboreum] gi|763754140|gb|KJB21471.1| hypothetical protein B456_004G083500 [Gossypium raimondii] Length = 93 Score = 110 bits (275), Expect = 4e-22 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 93 >ref|XP_007050686.1| BTB-POZ and MATH domain 2 [Theobroma cacao] gi|508702947|gb|EOX94843.1| BTB-POZ and MATH domain 2 [Theobroma cacao] Length = 493 Score = 110 bits (275), Expect = 4e-22 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 441 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 493 >ref|XP_006444137.1| hypothetical protein CICLE_v10023059mg [Citrus clementina] gi|568852209|ref|XP_006479772.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2-like [Citrus sinensis] gi|557546399|gb|ESR57377.1| hypothetical protein CICLE_v10023059mg [Citrus clementina] gi|641849947|gb|KDO68821.1| hypothetical protein CISIN_1g034490mg [Citrus sinensis] Length = 93 Score = 109 bits (273), Expect = 6e-22 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPPDGVDV+LLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVDLLHDATRREARGG 93 >ref|XP_010091130.1| hypothetical protein L484_011338 [Morus notabilis] gi|587852438|gb|EXB42565.1| hypothetical protein L484_011338 [Morus notabilis] Length = 140 Score = 109 bits (272), Expect = 8e-22 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 88 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 140 >ref|XP_010278777.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Nelumbo nucifera] Length = 93 Score = 109 bits (272), Expect = 8e-22 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPPDGVD++LLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDIDLLHDATRREARGG 93 >ref|XP_004493646.1| PREDICTED: sm-like protein LSM2 [Cicer arietinum] gi|747066248|ref|XP_011079802.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Sesamum indicum] gi|828300186|ref|XP_012569299.1| PREDICTED: sm-like protein LSM2 [Cicer arietinum] gi|848850144|ref|XP_012832661.1| PREDICTED: sm-like protein LSM2 [Erythranthe guttatus] gi|604348467|gb|EYU46622.1| hypothetical protein MIMGU_mgv1a017110mg [Erythranthe guttata] Length = 93 Score = 109 bits (272), Expect = 8e-22 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 93 >ref|XP_004294156.1| PREDICTED: sm-like protein LSM2 [Fragaria vesca subsp. vesca] Length = 93 Score = 109 bits (272), Expect = 8e-22 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 93 >ref|XP_004135926.1| PREDICTED: sm-like protein LSM2 [Cucumis sativus] gi|700189904|gb|KGN45137.1| hypothetical protein Csa_7G428250 [Cucumis sativus] Length = 93 Score = 109 bits (272), Expect = 8e-22 Identities = 51/53 (96%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD++KYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG Sbjct: 41 ENTRVVDQEKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 93 >ref|XP_010652110.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Vitis vinifera] Length = 126 Score = 108 bits (271), Expect = 1e-21 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 74 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 126 >ref|XP_008458018.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 isoform X2 [Cucumis melo] Length = 93 Score = 108 bits (271), Expect = 1e-21 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD++KYPHMLSVRNCFIRGSVVRYVQLPPDGVD+ELLHDATRREARGG Sbjct: 41 ENTRVVDQEKYPHMLSVRNCFIRGSVVRYVQLPPDGVDIELLHDATRREARGG 93 >emb|CBI32330.3| unnamed protein product [Vitis vinifera] Length = 137 Score = 108 bits (271), Expect = 1e-21 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 85 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 137 >ref|XP_003625831.1| SnRNP core Sm protein Sm-X5-like protein [Medicago truncatula] gi|355500846|gb|AES82049.1| u6 snRNA-associated-like-Smprotein [Medicago truncatula] gi|388519597|gb|AFK47860.1| unknown [Lotus japonicus] gi|728844373|gb|KHG23816.1| U6 snRNA-associated Sm-like protein LSm2 [Gossypium arboreum] Length = 93 Score = 108 bits (271), Expect = 1e-21 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 93 >ref|XP_007162394.1| hypothetical protein PHAVU_001G148500g [Phaseolus vulgaris] gi|561035858|gb|ESW34388.1| hypothetical protein PHAVU_001G148500g [Phaseolus vulgaris] Length = 125 Score = 108 bits (271), Expect = 1e-21 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPP+GVD+ELLHDATRREARGG Sbjct: 73 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDIELLHDATRREARGG 125 >gb|EPS69310.1| hypothetical protein M569_05456 [Genlisea aurea] Length = 93 Score = 108 bits (271), Expect = 1e-21 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRV+D++KYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG Sbjct: 41 ENTRVIDQEKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 93 >ref|XP_010909268.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Elaeis guineensis] Length = 93 Score = 108 bits (270), Expect = 1e-21 Identities = 49/53 (92%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPPDGVD+++LHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDIDILHDATRREARGG 93 >ref|XP_008372267.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Malus domestica] gi|657981949|ref|XP_008383008.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Malus domestica] gi|694327982|ref|XP_009354825.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Pyrus x bretschneideri] gi|694434144|ref|XP_009344313.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Pyrus x bretschneideri] gi|694442668|ref|XP_009347993.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Pyrus x bretschneideri] Length = 93 Score = 108 bits (270), Expect = 1e-21 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHM+SVRNCFIRGSVVRYVQLPP+GVDVELLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMMSVRNCFIRGSVVRYVQLPPEGVDVELLHDATRREARGG 93 >ref|XP_002304049.1| small nuclear ribonucleoprotein D [Populus trichocarpa] gi|743848741|ref|XP_011028302.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 isoform X1 [Populus euphratica] gi|743848745|ref|XP_011028303.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 isoform X2 [Populus euphratica] gi|743927394|ref|XP_011007870.1| PREDICTED: U6 snRNA-associated Sm-like protein LSm2 [Populus euphratica] gi|118484877|gb|ABK94305.1| unknown [Populus trichocarpa] gi|222841481|gb|EEE79028.1| small nuclear ribonucleoprotein D [Populus trichocarpa] Length = 93 Score = 108 bits (269), Expect = 2e-21 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPP+GVDV+LLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDVDLLHDATRREARGG 93 >gb|ABK93861.1| unknown [Populus trichocarpa] Length = 93 Score = 108 bits (269), Expect = 2e-21 Identities = 50/53 (94%), Positives = 53/53 (100%) Frame = +1 Query: 1 ENTRVVDRDKYPHMLSVRNCFIRGSVVRYVQLPPDGVDVELLHDATRREARGG 159 ENTRVVD+DKYPHMLSVRNCFIRGSVVRYVQLPP+GVDV+LLHDATRREARGG Sbjct: 41 ENTRVVDQDKYPHMLSVRNCFIRGSVVRYVQLPPEGVDVDLLHDATRREARGG 93