BLASTX nr result
ID: Forsythia23_contig00036189
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00036189 (521 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012455403.1| PREDICTED: inositol transporter 4-like [Goss... 61 3e-07 gb|KJB69169.1| hypothetical protein B456_011G009100, partial [Go... 61 3e-07 ref|XP_010057827.1| PREDICTED: inositol transporter 4-like [Euca... 60 7e-07 ref|XP_010057829.1| PREDICTED: inositol transporter 4-like [Euca... 60 7e-07 ref|XP_012849033.1| PREDICTED: inositol transporter 4-like [Eryt... 60 7e-07 ref|XP_010449779.1| PREDICTED: inositol transporter 4-like [Came... 58 3e-06 ref|XP_010440148.1| PREDICTED: inositol transporter 4-like [Came... 58 3e-06 ref|XP_010434813.1| PREDICTED: inositol transporter 4 [Camelina ... 58 3e-06 ref|XP_009145847.1| PREDICTED: inositol transporter 4-like [Bras... 58 3e-06 ref|XP_009136775.1| PREDICTED: inositol transporter 4 [Brassica ... 58 3e-06 emb|CDY09689.1| BnaC07g33720D [Brassica napus] 58 3e-06 ref|XP_006414343.1| hypothetical protein EUTSA_v10024765mg [Eutr... 58 3e-06 ref|XP_006282574.1| hypothetical protein CARUB_v10004447mg [Caps... 58 3e-06 ref|NP_193381.1| inositol transporter 4 [Arabidopsis thaliana] g... 58 3e-06 ref|XP_002870155.1| ATINT4 [Arabidopsis lyrata subsp. lyrata] gi... 58 3e-06 ref|XP_012850765.1| PREDICTED: inositol transporter 4-like [Eryt... 56 8e-06 ref|XP_012842615.1| PREDICTED: inositol transporter 4-like [Eryt... 56 8e-06 >ref|XP_012455403.1| PREDICTED: inositol transporter 4-like [Gossypium raimondii] Length = 597 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGISKPDK EF ECW+T WKTPYIMRLA Sbjct: 2 VEGGISKPDKTEFTECWKTTWKTPYIMRLA 31 >gb|KJB69169.1| hypothetical protein B456_011G009100, partial [Gossypium raimondii] Length = 573 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGISKPDK EF ECW+T WKTPYIMRLA Sbjct: 2 VEGGISKPDKTEFTECWKTTWKTPYIMRLA 31 >ref|XP_010057827.1| PREDICTED: inositol transporter 4-like [Eucalyptus grandis] Length = 575 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 MEGG +KPDK EF ECWRT WKTPYIMRLA Sbjct: 1 MEGGHTKPDKTEFTECWRTTWKTPYIMRLA 30 >ref|XP_010057829.1| PREDICTED: inositol transporter 4-like [Eucalyptus grandis] gi|629110010|gb|KCW75156.1| hypothetical protein EUGRSUZ_E03903 [Eucalyptus grandis] Length = 575 Score = 59.7 bits (143), Expect = 7e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 MEGG +KPDK EF ECWRT WKTPYIMRLA Sbjct: 1 MEGGHTKPDKTEFTECWRTTWKTPYIMRLA 30 >ref|XP_012849033.1| PREDICTED: inositol transporter 4-like [Erythranthe guttatus] gi|604314977|gb|EYU27683.1| hypothetical protein MIMGU_mgv1a003465mg [Erythranthe guttata] gi|604314978|gb|EYU27684.1| hypothetical protein MIMGU_mgv1a003465mg [Erythranthe guttata] Length = 583 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 MEGG++KPDK EF ECWRT WK PYIMRLA Sbjct: 1 MEGGVTKPDKTEFTECWRTSWKKPYIMRLA 30 >ref|XP_010449779.1| PREDICTED: inositol transporter 4-like [Camelina sativa] gi|727555231|ref|XP_010449780.1| PREDICTED: inositol transporter 4-like [Camelina sativa] Length = 582 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGI+K DK EF ECWRT WKTPYIMRLA Sbjct: 2 VEGGIAKADKTEFTECWRTTWKTPYIMRLA 31 >ref|XP_010440148.1| PREDICTED: inositol transporter 4-like [Camelina sativa] Length = 582 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGI+K DK EF ECWRT WKTPYIMRLA Sbjct: 2 VEGGIAKADKTEFTECWRTTWKTPYIMRLA 31 >ref|XP_010434813.1| PREDICTED: inositol transporter 4 [Camelina sativa] gi|727516872|ref|XP_010434814.1| PREDICTED: inositol transporter 4 [Camelina sativa] gi|727516874|ref|XP_010434815.1| PREDICTED: inositol transporter 4 [Camelina sativa] Length = 582 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGI+K DK EF ECWRT WKTPYIMRLA Sbjct: 2 VEGGIAKADKTEFTECWRTTWKTPYIMRLA 31 >ref|XP_009145847.1| PREDICTED: inositol transporter 4-like [Brassica rapa] gi|685261546|ref|XP_009145854.1| PREDICTED: inositol transporter 4-like [Brassica rapa] gi|685261548|ref|XP_009145862.1| PREDICTED: inositol transporter 4-like [Brassica rapa] Length = 581 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGI+K DK EF ECWRT WKTPYIMRLA Sbjct: 2 VEGGIAKADKTEFTECWRTTWKTPYIMRLA 31 >ref|XP_009136775.1| PREDICTED: inositol transporter 4 [Brassica rapa] gi|674942860|emb|CDX90519.1| BnaA03g42620D [Brassica napus] Length = 581 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGI+K DK EF ECWRT WKTPYIMRLA Sbjct: 2 VEGGIAKADKTEFTECWRTTWKTPYIMRLA 31 >emb|CDY09689.1| BnaC07g33720D [Brassica napus] Length = 659 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGI+K DK EF ECWRT WKTPYIMRLA Sbjct: 2 VEGGIAKADKTEFTECWRTTWKTPYIMRLA 31 >ref|XP_006414343.1| hypothetical protein EUTSA_v10024765mg [Eutrema salsugineum] gi|557115513|gb|ESQ55796.1| hypothetical protein EUTSA_v10024765mg [Eutrema salsugineum] Length = 581 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGI+K DK EF ECWRT WKTPYIMRLA Sbjct: 2 VEGGIAKADKTEFTECWRTTWKTPYIMRLA 31 >ref|XP_006282574.1| hypothetical protein CARUB_v10004447mg [Capsella rubella] gi|482551279|gb|EOA15472.1| hypothetical protein CARUB_v10004447mg [Capsella rubella] Length = 582 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGI+K DK EF ECWRT WKTPYIMRLA Sbjct: 2 VEGGIAKADKTEFTECWRTTWKTPYIMRLA 31 >ref|NP_193381.1| inositol transporter 4 [Arabidopsis thaliana] gi|75318122|sp|O23492.1|INT4_ARATH RecName: Full=Inositol transporter 4; AltName: Full=Myo-inositol-proton symporter INT4; AltName: Full=Protein INOSITOL TRANSPORTER 4 gi|2245004|emb|CAB10424.1| membrane transporter like protein [Arabidopsis thaliana] gi|7268398|emb|CAB78690.1| membrane transporter like protein [Arabidopsis thaliana] gi|28393478|gb|AAO42160.1| putative membrane transporter [Arabidopsis thaliana] gi|28973605|gb|AAO64127.1| putative membrane transporter [Arabidopsis thaliana] gi|84617973|emb|CAJ00306.1| inositol transporter 4 [Arabidopsis thaliana] gi|332658359|gb|AEE83759.1| inositol transporter 4 [Arabidopsis thaliana] Length = 582 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGI+K DK EF ECWRT WKTPYIMRLA Sbjct: 2 VEGGIAKADKTEFTECWRTTWKTPYIMRLA 31 >ref|XP_002870155.1| ATINT4 [Arabidopsis lyrata subsp. lyrata] gi|297315991|gb|EFH46414.1| ATINT4 [Arabidopsis lyrata subsp. lyrata] Length = 582 Score = 57.8 bits (138), Expect = 3e-06 Identities = 24/30 (80%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGI+K DK EF ECWRT WKTPYIMRLA Sbjct: 2 VEGGIAKADKTEFTECWRTTWKTPYIMRLA 31 >ref|XP_012850765.1| PREDICTED: inositol transporter 4-like [Erythranthe guttatus] Length = 581 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGI++ DK EF ECWRT WKTPYIMRLA Sbjct: 2 VEGGIAQADKTEFTECWRTSWKTPYIMRLA 31 >ref|XP_012842615.1| PREDICTED: inositol transporter 4-like [Erythranthe guttatus] gi|604327239|gb|EYU33093.1| hypothetical protein MIMGU_mgv1a003520mg [Erythranthe guttata] Length = 580 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = -2 Query: 91 MEGGISKPDKIEFIECWRTRWKTPYIMRLA 2 +EGGI++ DK EF ECWRT WKTPYIMRLA Sbjct: 2 VEGGIAQADKTEFTECWRTSWKTPYIMRLA 31