BLASTX nr result
ID: Forsythia23_contig00036075
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00036075 (415 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012852410.1| PREDICTED: uncharacterized protein LOC105972... 58 3e-06 gb|EYU24919.1| hypothetical protein MIMGU_mgv1a025903mg [Erythra... 58 3e-06 ref|XP_011100438.1| PREDICTED: uncharacterized protein LOC105178... 57 4e-06 >ref|XP_012852410.1| PREDICTED: uncharacterized protein LOC105972020 [Erythranthe guttatus] Length = 220 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 187 APRIERKIVEKNRRDRMKILYSNLLSLLPNHGSKV 83 APRIERKI EKNRR++MK+L+SNL SLLP+H SKV Sbjct: 16 APRIERKITEKNRRNQMKLLFSNLTSLLPHHTSKV 50 >gb|EYU24919.1| hypothetical protein MIMGU_mgv1a025903mg [Erythranthe guttata] Length = 216 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -1 Query: 187 APRIERKIVEKNRRDRMKILYSNLLSLLPNHGSKV 83 APRIERKI EKNRR++MK+L+SNL SLLP+H SKV Sbjct: 16 APRIERKITEKNRRNQMKLLFSNLTSLLPHHTSKV 50 >ref|XP_011100438.1| PREDICTED: uncharacterized protein LOC105178626 [Sesamum indicum] Length = 222 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 187 APRIERKIVEKNRRDRMKILYSNLLSLLPNHGSK 86 APRIERK++EKNRR+RMK L SNL+SLLPNH SK Sbjct: 21 APRIERKVIEKNRRNRMKGLCSNLISLLPNHTSK 54