BLASTX nr result
ID: Forsythia23_contig00035741
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00035741 (354 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010059775.1| PREDICTED: serpin-ZX-like [Eucalyptus grandi... 57 5e-06 gb|KEH31018.1| serpin-like protein [Medicago truncatula] 56 8e-06 >ref|XP_010059775.1| PREDICTED: serpin-ZX-like [Eucalyptus grandis] gi|629100741|gb|KCW66210.1| hypothetical protein EUGRSUZ_F00034 [Eucalyptus grandis] Length = 390 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 261 AVEATKEVNLWAEKETSGLIKEILPSGSVDG 353 AVE T EVN WAEKETSGLIKE+LP+GSVDG Sbjct: 131 AVEVTSEVNTWAEKETSGLIKEVLPAGSVDG 161 >gb|KEH31018.1| serpin-like protein [Medicago truncatula] Length = 382 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 261 AVEATKEVNLWAEKETSGLIKEILPSGSVD 350 A+E TKEVNLWAEKET+GLIKE+LP GSVD Sbjct: 132 AIEVTKEVNLWAEKETNGLIKELLPQGSVD 161