BLASTX nr result
ID: Forsythia23_contig00035482
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00035482 (494 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012834278.1| PREDICTED: intracellular protein transport p... 108 1e-21 gb|EYU40034.1| hypothetical protein MIMGU_mgv1a020685mg, partial... 108 1e-21 ref|XP_011074267.1| PREDICTED: putative leucine-rich repeat-cont... 108 2e-21 emb|CDP12127.1| unnamed protein product [Coffea canephora] 100 6e-19 ref|XP_012854125.1| PREDICTED: intracellular protein transport p... 99 8e-19 gb|EYU23384.1| hypothetical protein MIMGU_mgv1a025100mg, partial... 99 8e-19 ref|XP_011101058.1| PREDICTED: interaptin-like [Sesamum indicum] 98 2e-18 ref|XP_009800860.1| PREDICTED: intracellular protein transport p... 96 9e-18 ref|XP_009611885.1| PREDICTED: spindle pole body component 110-l... 96 9e-18 ref|XP_009611883.1| PREDICTED: spindle pole body component 110-l... 96 9e-18 ref|XP_010324678.1| PREDICTED: intracellular protein transport p... 94 3e-17 ref|XP_009768983.1| PREDICTED: intracellular protein transport p... 94 3e-17 ref|XP_009768982.1| PREDICTED: intracellular protein transport p... 94 3e-17 ref|XP_009620190.1| PREDICTED: uncharacterized protein LOC104112... 94 3e-17 gb|EPS73904.1| hypothetical protein M569_00852, partial [Genlise... 94 5e-17 ref|XP_006352308.1| PREDICTED: intracellular protein transport p... 92 2e-16 ref|XP_010314498.1| PREDICTED: myosin heavy chain, clone 203 [So... 90 5e-16 ref|XP_006360741.1| PREDICTED: intracellular protein transport p... 88 3e-15 ref|XP_007160143.1| hypothetical protein PHAVU_002G296300g [Phas... 77 4e-12 gb|KHN16755.1| hypothetical protein glysoja_002852 [Glycine soja] 74 3e-11 >ref|XP_012834278.1| PREDICTED: intracellular protein transport protein USO1 [Erythranthe guttatus] Length = 678 Score = 108 bits (271), Expect = 1e-21 Identities = 51/64 (79%), Positives = 56/64 (87%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLTEITPGY 315 WK ENKVRELEK+ K EDGML +QEEKREAIRQLCVWIDYHRSRSDYY KML+EI PG Sbjct: 615 WKLENKVRELEKVIKEREDGMLGLQEEKREAIRQLCVWIDYHRSRSDYYMKMLSEINPGR 674 Query: 314 RRTS 303 R++S Sbjct: 675 RKSS 678 >gb|EYU40034.1| hypothetical protein MIMGU_mgv1a020685mg, partial [Erythranthe guttata] Length = 718 Score = 108 bits (271), Expect = 1e-21 Identities = 51/64 (79%), Positives = 56/64 (87%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLTEITPGY 315 WK ENKVRELEK+ K EDGML +QEEKREAIRQLCVWIDYHRSRSDYY KML+EI PG Sbjct: 655 WKLENKVRELEKVIKEREDGMLGLQEEKREAIRQLCVWIDYHRSRSDYYMKMLSEINPGR 714 Query: 314 RRTS 303 R++S Sbjct: 715 RKSS 718 >ref|XP_011074267.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503 [Sesamum indicum] Length = 2583 Score = 108 bits (269), Expect = 2e-21 Identities = 49/64 (76%), Positives = 57/64 (89%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLTEITPGY 315 WKSENK+RELEKM K E+GML +QEEKREAIRQLCVWIDYHRSRSDYYKKML+E+ G Sbjct: 691 WKSENKIRELEKMIKEKEEGMLGLQEEKREAIRQLCVWIDYHRSRSDYYKKMLSEVNRGR 750 Query: 314 RRTS 303 R+++ Sbjct: 751 RKSA 754 >emb|CDP12127.1| unnamed protein product [Coffea canephora] Length = 823 Score = 99.8 bits (247), Expect = 6e-19 Identities = 46/64 (71%), Positives = 54/64 (84%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLTEITPGY 315 WKSENKVRELEKM NE+ ML ++EEKREAIRQLCVWIDYHRS SDYYKKM+++ T Sbjct: 760 WKSENKVRELEKMITENEEAMLALKEEKREAIRQLCVWIDYHRSHSDYYKKMMSDKTLQS 819 Query: 314 RRTS 303 R+T+ Sbjct: 820 RKTT 823 >ref|XP_012854125.1| PREDICTED: intracellular protein transport protein USO1 [Erythranthe guttatus] Length = 757 Score = 99.4 bits (246), Expect = 8e-19 Identities = 47/64 (73%), Positives = 55/64 (85%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLTEITPGY 315 W+SEN+VRELEKM K EDG+LV++EEKREAIRQLCVWIDYHRSRSDYYKK+L++ Sbjct: 694 WESENRVRELEKMIKEREDGVLVMEEEKREAIRQLCVWIDYHRSRSDYYKKILSDQMNLR 753 Query: 314 RRTS 303 RR S Sbjct: 754 RRPS 757 >gb|EYU23384.1| hypothetical protein MIMGU_mgv1a025100mg, partial [Erythranthe guttata] Length = 730 Score = 99.4 bits (246), Expect = 8e-19 Identities = 47/64 (73%), Positives = 55/64 (85%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLTEITPGY 315 W+SEN+VRELEKM K EDG+LV++EEKREAIRQLCVWIDYHRSRSDYYKK+L++ Sbjct: 667 WESENRVRELEKMIKEREDGVLVMEEEKREAIRQLCVWIDYHRSRSDYYKKILSDQMNLR 726 Query: 314 RRTS 303 RR S Sbjct: 727 RRPS 730 >ref|XP_011101058.1| PREDICTED: interaptin-like [Sesamum indicum] Length = 1712 Score = 98.2 bits (243), Expect = 2e-18 Identities = 45/56 (80%), Positives = 49/56 (87%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLTEI 327 WKSENKVRELEKM K ED ML +EEKREAIRQLCVWIDYHR RSDYYKKM++E+ Sbjct: 728 WKSENKVRELEKMMKEKEDAMLGFKEEKREAIRQLCVWIDYHRGRSDYYKKMVSEM 783 >ref|XP_009800860.1| PREDICTED: intracellular protein transport protein USO1-like [Nicotiana sylvestris] gi|698511544|ref|XP_009800861.1| PREDICTED: intracellular protein transport protein USO1-like [Nicotiana sylvestris] gi|698511547|ref|XP_009800862.1| PREDICTED: intracellular protein transport protein USO1-like [Nicotiana sylvestris] Length = 802 Score = 95.9 bits (237), Expect = 9e-18 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLT 333 WKS+NKVRELEKM K +DGML ++EEKREAIRQLC+WIDYHRSRSDYY+K L+ Sbjct: 741 WKSDNKVRELEKMIKEKDDGMLALKEEKREAIRQLCIWIDYHRSRSDYYQKSLS 794 >ref|XP_009611885.1| PREDICTED: spindle pole body component 110-like isoform X2 [Nicotiana tomentosiformis] Length = 802 Score = 95.9 bits (237), Expect = 9e-18 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLT 333 WKS+NKVRELEKM K +DGML ++EEKREAIRQLC+WIDYHRSRSDYY+K L+ Sbjct: 741 WKSDNKVRELEKMIKEKDDGMLALKEEKREAIRQLCIWIDYHRSRSDYYQKSLS 794 >ref|XP_009611883.1| PREDICTED: spindle pole body component 110-like isoform X1 [Nicotiana tomentosiformis] gi|697115936|ref|XP_009611884.1| PREDICTED: spindle pole body component 110-like isoform X1 [Nicotiana tomentosiformis] Length = 816 Score = 95.9 bits (237), Expect = 9e-18 Identities = 42/54 (77%), Positives = 49/54 (90%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLT 333 WKS+NKVRELEKM K +DGML ++EEKREAIRQLC+WIDYHRSRSDYY+K L+ Sbjct: 755 WKSDNKVRELEKMIKEKDDGMLALKEEKREAIRQLCIWIDYHRSRSDYYQKSLS 808 >ref|XP_010324678.1| PREDICTED: intracellular protein transport protein USO1-like [Solanum lycopersicum] Length = 847 Score = 94.4 bits (233), Expect = 3e-17 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKML 336 WKSENKVRELEKM K E+ ML ++EEKREAIRQLCVWIDYHRSRSDYYK++L Sbjct: 785 WKSENKVRELEKMIKDREESMLSLKEEKREAIRQLCVWIDYHRSRSDYYKRIL 837 >ref|XP_009768983.1| PREDICTED: intracellular protein transport protein USO1 isoform X2 [Nicotiana sylvestris] Length = 785 Score = 94.4 bits (233), Expect = 3e-17 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKML 336 WK ENKVRELEKM K E+ MLV++EEKREAIRQLCVWIDYHRSRSDYYK++L Sbjct: 723 WKLENKVRELEKMIKDQEESMLVLKEEKREAIRQLCVWIDYHRSRSDYYKRIL 775 >ref|XP_009768982.1| PREDICTED: intracellular protein transport protein USO1 isoform X1 [Nicotiana sylvestris] Length = 839 Score = 94.4 bits (233), Expect = 3e-17 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKML 336 WK ENKVRELEKM K E+ MLV++EEKREAIRQLCVWIDYHRSRSDYYK++L Sbjct: 777 WKLENKVRELEKMIKDQEESMLVLKEEKREAIRQLCVWIDYHRSRSDYYKRIL 829 >ref|XP_009620190.1| PREDICTED: uncharacterized protein LOC104112065 [Nicotiana tomentosiformis] Length = 1897 Score = 94.4 bits (233), Expect = 3e-17 Identities = 43/53 (81%), Positives = 48/53 (90%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKML 336 WK ENKVRELEKM K E+ MLV++EEKREAIRQLCVWIDYHRSRSDYYK++L Sbjct: 1835 WKLENKVRELEKMIKDQEESMLVLKEEKREAIRQLCVWIDYHRSRSDYYKRIL 1887 >gb|EPS73904.1| hypothetical protein M569_00852, partial [Genlisea aurea] Length = 280 Score = 93.6 bits (231), Expect = 5e-17 Identities = 43/56 (76%), Positives = 49/56 (87%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLTEI 327 W+SENKVRELEK ++ ED +L I EEKREAIRQLCVWIDYHR+RSDYYKK L+EI Sbjct: 221 WRSENKVRELEKASEEREDTVLGIMEEKREAIRQLCVWIDYHRARSDYYKKTLSEI 276 >ref|XP_006352308.1| PREDICTED: intracellular protein transport protein USO1-like [Solanum tuberosum] Length = 905 Score = 91.7 bits (226), Expect = 2e-16 Identities = 41/53 (77%), Positives = 48/53 (90%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKML 336 WKSEN+VRELEKM K E+ +L ++EEKREAIRQLCVWIDYHRSRSDYYK++L Sbjct: 843 WKSENRVRELEKMIKDREESVLSLKEEKREAIRQLCVWIDYHRSRSDYYKRIL 895 >ref|XP_010314498.1| PREDICTED: myosin heavy chain, clone 203 [Solanum lycopersicum] Length = 717 Score = 90.1 bits (222), Expect = 5e-16 Identities = 40/54 (74%), Positives = 47/54 (87%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLT 333 WKS+NKVRELEKM K +D ML ++EEKREAIRQLC+WIDYHRSRS YY+K L+ Sbjct: 656 WKSDNKVRELEKMIKEKDDSMLALKEEKREAIRQLCIWIDYHRSRSVYYQKSLS 709 >ref|XP_006360741.1| PREDICTED: intracellular protein transport protein USO1-like [Solanum tuberosum] Length = 728 Score = 87.8 bits (216), Expect = 3e-15 Identities = 39/54 (72%), Positives = 46/54 (85%) Frame = -1 Query: 494 WKSENKVRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLT 333 WKS+NKVRELEKM K +D L ++EEKREAIRQLC+WIDYHRSRS YY+K L+ Sbjct: 667 WKSDNKVRELEKMIKEKDDSTLALKEEKREAIRQLCIWIDYHRSRSVYYQKSLS 720 >ref|XP_007160143.1| hypothetical protein PHAVU_002G296300g [Phaseolus vulgaris] gi|561033558|gb|ESW32137.1| hypothetical protein PHAVU_002G296300g [Phaseolus vulgaris] Length = 1398 Score = 77.0 bits (188), Expect = 4e-12 Identities = 37/55 (67%), Positives = 41/55 (74%) Frame = -1 Query: 476 VRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLTEITPGYR 312 VRELEKM K EDGML + EEKRE IRQLC+WIDYHRSR DY K +L+ G R Sbjct: 1342 VRELEKMMKEKEDGMLDLGEEKREVIRQLCLWIDYHRSRYDYLKDVLSNTRRGQR 1396 >gb|KHN16755.1| hypothetical protein glysoja_002852 [Glycine soja] Length = 1405 Score = 74.3 bits (181), Expect = 3e-11 Identities = 36/55 (65%), Positives = 41/55 (74%) Frame = -1 Query: 476 VRELEKMNKHNEDGMLVIQEEKREAIRQLCVWIDYHRSRSDYYKKMLTEITPGYR 312 V ELEKM K EDGML + EEKRE IRQLC+WIDYHRSR DY K +L++ G R Sbjct: 1349 VGELEKMMKEKEDGMLDLGEEKREVIRQLCLWIDYHRSRYDYLKDILSKSRRGQR 1403