BLASTX nr result
ID: Forsythia23_contig00035394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00035394 (552 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088276.1| PREDICTED: B3 domain-containing protein At3g... 82 1e-13 ref|XP_004230782.1| PREDICTED: B3 domain-containing protein At5g... 78 3e-12 ref|XP_006346418.1| PREDICTED: B3 domain-containing protein Os01... 75 2e-11 ref|XP_006346416.1| PREDICTED: B3 domain-containing protein Os01... 75 2e-11 emb|CDO97164.1| unnamed protein product [Coffea canephora] 72 1e-10 ref|XP_009612760.1| PREDICTED: B3 domain-containing protein At5g... 63 9e-08 ref|XP_009612758.1| PREDICTED: B3 domain-containing protein At5g... 63 9e-08 ref|XP_011088278.1| PREDICTED: B3 domain-containing protein At5g... 60 8e-07 ref|XP_009772550.1| PREDICTED: B3 domain-containing protein At5g... 57 4e-06 ref|XP_009772548.1| PREDICTED: B3 domain-containing protein At5g... 57 4e-06 >ref|XP_011088276.1| PREDICTED: B3 domain-containing protein At3g19184-like isoform X1 [Sesamum indicum] Length = 313 Score = 82.0 bits (201), Expect = 1e-13 Identities = 50/120 (41%), Positives = 62/120 (51%), Gaps = 4/120 (3%) Frame = -3 Query: 550 VRVNGTXXXXXXXXXXXXXXCRNGVGSDLXXXXXXXXXXXXXVEPFLHDISTPQESIQSK 371 VRVN + R G ++ VEPFL DISTP +++K Sbjct: 196 VRVNDSDVVGAALCLMDMDASRRGTNAESMKRDNKKRKKTKYVEPFLLDISTP---LENK 252 Query: 370 GKNTLNSS----LDQSESNSDGFGSEVLQGSVITNRLPSKDFCYSETSFLHDHPHEGVTC 203 GKN +S D+S S DGF EV++GS ITN+ SKD CY +TSFLHDH EGV C Sbjct: 253 GKNAPSSIPAPVADRSASKGDGFSYEVIEGSEITNQPQSKDLCYPKTSFLHDHSREGVIC 312 >ref|XP_004230782.1| PREDICTED: B3 domain-containing protein At5g42700 [Solanum lycopersicum] Length = 336 Score = 77.8 bits (190), Expect = 3e-12 Identities = 38/77 (49%), Positives = 53/77 (68%), Gaps = 4/77 (5%) Frame = -3 Query: 421 EPFLHDISTPQESIQSKGKNTLNSSLD----QSESNSDGFGSEVLQGSVITNRLPSKDFC 254 EPF D+S P+E +Q+ T++ ++ +SE+NS+ SEVLQGS +TNRL S + C Sbjct: 259 EPFFVDLSKPKEHVQNDSHCTVDLNVSPSEHRSENNSEDLDSEVLQGSDVTNRLQSNEIC 318 Query: 253 YSETSFLHDHPHEGVTC 203 SETSFLHD+PH+ V C Sbjct: 319 CSETSFLHDNPHKSVDC 335 >ref|XP_006346418.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform X3 [Solanum tuberosum] Length = 267 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/77 (45%), Positives = 52/77 (67%), Gaps = 4/77 (5%) Frame = -3 Query: 421 EPFLHDISTPQESIQSKGKNTLNSSLD----QSESNSDGFGSEVLQGSVITNRLPSKDFC 254 EPF D+S P+E +Q+ ++ ++ +SE+NS+ SEVL+GS +TNRL S + C Sbjct: 190 EPFFVDLSKPKEHVQNDSHCAVDLNVSPSEHRSENNSEDLDSEVLEGSDVTNRLQSNEIC 249 Query: 253 YSETSFLHDHPHEGVTC 203 SETSFLHD+PH+ + C Sbjct: 250 CSETSFLHDNPHKSIAC 266 >ref|XP_006346416.1| PREDICTED: B3 domain-containing protein Os01g0234100-like isoform X1 [Solanum tuberosum] Length = 334 Score = 74.7 bits (182), Expect = 2e-11 Identities = 35/77 (45%), Positives = 52/77 (67%), Gaps = 4/77 (5%) Frame = -3 Query: 421 EPFLHDISTPQESIQSKGKNTLNSSLD----QSESNSDGFGSEVLQGSVITNRLPSKDFC 254 EPF D+S P+E +Q+ ++ ++ +SE+NS+ SEVL+GS +TNRL S + C Sbjct: 257 EPFFVDLSKPKEHVQNDSHCAVDLNVSPSEHRSENNSEDLDSEVLEGSDVTNRLQSNEIC 316 Query: 253 YSETSFLHDHPHEGVTC 203 SETSFLHD+PH+ + C Sbjct: 317 CSETSFLHDNPHKSIAC 333 >emb|CDO97164.1| unnamed protein product [Coffea canephora] Length = 320 Score = 72.4 bits (176), Expect = 1e-10 Identities = 37/66 (56%), Positives = 46/66 (69%), Gaps = 4/66 (6%) Frame = -3 Query: 388 ESIQSKGKNTLNSSL----DQSESNSDGFGSEVLQGSVITNRLPSKDFCYSETSFLHDHP 221 + +Q KGK L S L DQSE+ SDGFGSEVL+GS +T+ L S D ++E SFLH+HP Sbjct: 254 DKVQEKGKMVLKSDLVPVEDQSENTSDGFGSEVLEGSGMTDHLLSGDHHHTEASFLHEHP 313 Query: 220 HEGVTC 203 EGV C Sbjct: 314 CEGVVC 319 >ref|XP_009612760.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform X2 [Nicotiana tomentosiformis] Length = 338 Score = 62.8 bits (151), Expect = 9e-08 Identities = 34/81 (41%), Positives = 50/81 (61%), Gaps = 8/81 (9%) Frame = -3 Query: 421 EPFLHDISTPQESIQSKGKNTLN----SSLDQSESNSDGFGSEV----LQGSVITNRLPS 266 EPF D S P+E IQ+ + ++ S+ +SE+NS+ SEV + GS + NRL S Sbjct: 257 EPFYVDFSKPKEYIQNDSHSAVDLNVSPSVHRSETNSEVLDSEVPEGFIAGSDVINRLQS 316 Query: 265 KDFCYSETSFLHDHPHEGVTC 203 + C SETSFLHD+P + ++C Sbjct: 317 NEICCSETSFLHDNPQKSISC 337 >ref|XP_009612758.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform X1 [Nicotiana tomentosiformis] gi|697117634|ref|XP_009612759.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform X1 [Nicotiana tomentosiformis] Length = 339 Score = 62.8 bits (151), Expect = 9e-08 Identities = 34/81 (41%), Positives = 50/81 (61%), Gaps = 8/81 (9%) Frame = -3 Query: 421 EPFLHDISTPQESIQSKGKNTLN----SSLDQSESNSDGFGSEV----LQGSVITNRLPS 266 EPF D S P+E IQ+ + ++ S+ +SE+NS+ SEV + GS + NRL S Sbjct: 258 EPFYVDFSKPKEYIQNDSHSAVDLNVSPSVHRSETNSEVLDSEVPEGFIAGSDVINRLQS 317 Query: 265 KDFCYSETSFLHDHPHEGVTC 203 + C SETSFLHD+P + ++C Sbjct: 318 NEICCSETSFLHDNPQKSISC 338 >ref|XP_011088278.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform X2 [Sesamum indicum] Length = 301 Score = 59.7 bits (143), Expect = 8e-07 Identities = 42/116 (36%), Positives = 51/116 (43%) Frame = -3 Query: 550 VRVNGTXXXXXXXXXXXXXXCRNGVGSDLXXXXXXXXXXXXXVEPFLHDISTPQESIQSK 371 VRVN + R G ++ VEPFL DISTP +++K Sbjct: 196 VRVNDSDVVGAALCLMDMDASRRGTNAESMKRDNKKRKKTKYVEPFLLDISTP---LENK 252 Query: 370 GKNTLNSSLDQSESNSDGFGSEVLQGSVITNRLPSKDFCYSETSFLHDHPHEGVTC 203 GKN +S S S ITN+ SKD CY +TSFLHDH EGV C Sbjct: 253 GKNAPSSIPAPVADRS--------ASSEITNQPQSKDLCYPKTSFLHDHSREGVIC 300 >ref|XP_009772550.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform X2 [Nicotiana sylvestris] Length = 338 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 8/81 (9%) Frame = -3 Query: 421 EPFLHDISTPQESIQSKGKNTLNSSLD----QSESNSDGFGSEV----LQGSVITNRLPS 266 EPF D S P+E IQ+ + ++ ++ +SE+NS+ SEV + GS + NRL S Sbjct: 257 EPFYVDFSKPKEYIQNDSHSAVDLNVSPSGHRSETNSEVLDSEVPEGFIAGSDVINRLQS 316 Query: 265 KDFCYSETSFLHDHPHEGVTC 203 + SETSFLHD+P ++C Sbjct: 317 NEISCSETSFLHDNPQNSISC 337 >ref|XP_009772548.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform X1 [Nicotiana sylvestris] gi|698562925|ref|XP_009772549.1| PREDICTED: B3 domain-containing protein At5g42700-like isoform X1 [Nicotiana sylvestris] Length = 339 Score = 57.4 bits (137), Expect = 4e-06 Identities = 32/81 (39%), Positives = 48/81 (59%), Gaps = 8/81 (9%) Frame = -3 Query: 421 EPFLHDISTPQESIQSKGKNTLNSSLD----QSESNSDGFGSEV----LQGSVITNRLPS 266 EPF D S P+E IQ+ + ++ ++ +SE+NS+ SEV + GS + NRL S Sbjct: 258 EPFYVDFSKPKEYIQNDSHSAVDLNVSPSGHRSETNSEVLDSEVPEGFIAGSDVINRLQS 317 Query: 265 KDFCYSETSFLHDHPHEGVTC 203 + SETSFLHD+P ++C Sbjct: 318 NEISCSETSFLHDNPQNSISC 338