BLASTX nr result
ID: Forsythia23_contig00035357
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00035357 (305 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012848122.1| PREDICTED: uncharacterized protein At4g14100... 80 4e-13 ref|XP_011086903.1| PREDICTED: uncharacterized protein At4g14100... 69 9e-10 >ref|XP_012848122.1| PREDICTED: uncharacterized protein At4g14100-like [Erythranthe guttatus] gi|604315922|gb|EYU28487.1| hypothetical protein MIMGU_mgv1a013476mg [Erythranthe guttata] Length = 219 Score = 80.5 bits (197), Expect = 4e-13 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = +3 Query: 3 EVGAVLEDAKWQAPVYCFDKKDVKPGYNSDNKVDVNFLKPQLEGVLRGSMQL 158 EVGAVLEDAKWQAP+YCFDKKD + + KVDV + +PQ EGVLRGSMQL Sbjct: 168 EVGAVLEDAKWQAPIYCFDKKDTQTDLRHNYKVDVGYSEPQTEGVLRGSMQL 219 >ref|XP_011086903.1| PREDICTED: uncharacterized protein At4g14100 [Sesamum indicum] Length = 237 Score = 69.3 bits (168), Expect = 9e-10 Identities = 32/52 (61%), Positives = 39/52 (75%) Frame = +3 Query: 3 EVGAVLEDAKWQAPVYCFDKKDVKPGYNSDNKVDVNFLKPQLEGVLRGSMQL 158 EVGAVLEDAKWQAPVYCF+KK ++K+DV + +PQLE +L G MQL Sbjct: 186 EVGAVLEDAKWQAPVYCFEKKKDTESDLKESKLDVGYFEPQLESILGGPMQL 237