BLASTX nr result
ID: Forsythia23_contig00035204
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00035204 (439 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097791.1| PREDICTED: scarecrow-like protein 21 isoform... 61 3e-07 >ref|XP_011097791.1| PREDICTED: scarecrow-like protein 21 isoform X1 [Sesamum indicum] gi|747099471|ref|XP_011097792.1| PREDICTED: scarecrow-like protein 21 isoform X1 [Sesamum indicum] gi|747099473|ref|XP_011097793.1| PREDICTED: scarecrow-like protein 21 isoform X1 [Sesamum indicum] Length = 535 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/48 (62%), Positives = 36/48 (75%) Frame = +1 Query: 289 TSQNHESLDGATRFYPQPLDELESYLLAPSDNLDHCISYEGGSHCTQF 432 TSQNH+++ G+ RF QPL+ELESYLL PS NLDH IS +G S QF Sbjct: 2 TSQNHDNIAGSGRFVHQPLEELESYLLDPSCNLDHFISCDGESQGIQF 49