BLASTX nr result
ID: Forsythia23_contig00034223
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00034223 (360 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012834815.1| PREDICTED: pentatricopeptide repeat-containi... 76 1e-11 emb|CDP04176.1| unnamed protein product [Coffea canephora] 71 2e-10 ref|XP_011084656.1| PREDICTED: pentatricopeptide repeat-containi... 69 9e-10 ref|XP_010317479.1| PREDICTED: pentatricopeptide repeat-containi... 68 2e-09 ref|XP_008230554.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_006350584.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 ref|XP_007216273.1| hypothetical protein PRUPE_ppa017372mg, part... 68 3e-09 ref|XP_009783577.1| PREDICTED: pentatricopeptide repeat-containi... 67 4e-09 ref|XP_009606050.1| PREDICTED: pentatricopeptide repeat-containi... 67 5e-09 ref|XP_006446568.1| hypothetical protein CICLE_v10018361mg, part... 64 3e-08 ref|XP_011011828.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 ref|XP_008365381.1| PREDICTED: pentatricopeptide repeat-containi... 64 4e-08 gb|KDO55175.1| hypothetical protein CISIN_1g037911mg, partial [C... 64 5e-08 ref|XP_006470265.1| PREDICTED: pentatricopeptide repeat-containi... 64 5e-08 ref|XP_009334116.1| PREDICTED: pentatricopeptide repeat-containi... 63 7e-08 ref|XP_012072391.1| PREDICTED: pentatricopeptide repeat-containi... 61 3e-07 ref|XP_002521455.1| pentatricopeptide repeat-containing protein,... 59 1e-06 emb|CAN65388.1| hypothetical protein VITISV_038361 [Vitis vinifera] 59 1e-06 ref|XP_002324003.1| hypothetical protein POPTR_0017s10790g [Popu... 59 1e-06 ref|XP_010690025.1| PREDICTED: pentatricopeptide repeat-containi... 57 6e-06 >ref|XP_012834815.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Erythranthe guttatus] Length = 635 Score = 75.9 bits (185), Expect = 1e-11 Identities = 46/97 (47%), Positives = 54/97 (55%), Gaps = 4/97 (4%) Frame = -1 Query: 279 MIRKLKSINY-LPPVSTPIFTNIFQXXXXXXXXXS---LQKITESNETKKILSNPLYNFL 112 M LKS + LP S IFT + S LQ + S+ K + NP Y FL Sbjct: 1 MSSSLKSATHRLPQFSVAIFTAPIRRSNPRNCSTSSSALQTLISSSIEKPVRHNPFYEFL 60 Query: 111 PETQNPNNLVNLICSSLKQKNNAHLAILQEQGLFSHF 1 PETQNPNN+V L+CSSLKQK+ LQEQGLF HF Sbjct: 61 PETQNPNNVVTLVCSSLKQKDRVFWDYLQEQGLFRHF 97 >emb|CDP04176.1| unnamed protein product [Coffea canephora] Length = 643 Score = 71.2 bits (173), Expect = 2e-10 Identities = 35/64 (54%), Positives = 48/64 (75%), Gaps = 6/64 (9%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAI------LQEQG 16 LQ++ + N+ K I SNP YN LPETQNPNN+V+L+CS+LK K++AHL++ +QEQG Sbjct: 35 LQRVPDINKNKPI-SNPFYNLLPETQNPNNIVSLVCSTLKLKDDAHLSLSLLHKTMQEQG 93 Query: 15 LFSH 4 SH Sbjct: 94 HLSH 97 >ref|XP_011084656.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Sesamum indicum] Length = 626 Score = 69.3 bits (168), Expect = 9e-10 Identities = 32/49 (65%), Positives = 38/49 (77%) Frame = -1 Query: 147 KKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQEQGLFSHF 1 K I +NPLYNFLPETQNPNN+V L+CSSLK K+ L L++QG FS F Sbjct: 41 KPITNNPLYNFLPETQNPNNVVALVCSSLKLKDGVFLEYLRQQGSFSRF 89 >ref|XP_010317479.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Solanum lycopersicum] gi|723679165|ref|XP_010317480.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Solanum lycopersicum] Length = 629 Score = 68.2 bits (165), Expect = 2e-09 Identities = 33/63 (52%), Positives = 46/63 (73%), Gaps = 4/63 (6%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQ----EQGLF 10 LQ +T+ N + + +SNPL+NFLP+TQNP N V+LICS+LK NN HL++LQ + GL Sbjct: 36 LQILTDYNGSARPISNPLHNFLPKTQNPQNTVSLICSALKNGNNDHLSLLQKTIRDNGLI 95 Query: 9 SHF 1 +F Sbjct: 96 CYF 98 >ref|XP_008230554.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Prunus mume] Length = 636 Score = 67.8 bits (164), Expect = 3e-09 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQ 25 LQ I +S+ +SNPLY+FLP+TQNPNN+VNLICSSLKQ NAHLA+LQ Sbjct: 45 LQTIPDSHSIS--VSNPLYHFLPQTQNPNNIVNLICSSLKQ-GNAHLALLQ 92 >ref|XP_006350584.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X1 [Solanum tuberosum] gi|565367885|ref|XP_006350585.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X2 [Solanum tuberosum] gi|565367887|ref|XP_006350586.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X3 [Solanum tuberosum] gi|565367889|ref|XP_006350587.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X4 [Solanum tuberosum] gi|565367891|ref|XP_006350588.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X5 [Solanum tuberosum] Length = 629 Score = 67.8 bits (164), Expect = 3e-09 Identities = 32/63 (50%), Positives = 47/63 (74%), Gaps = 4/63 (6%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAIL----QEQGLF 10 +Q +T+ + + + SNPL+NFLP+TQNP N V+LICS+LK +NN HL++L Q+ GL Sbjct: 36 VQILTDYSGSARPFSNPLHNFLPKTQNPQNTVSLICSALKNRNNDHLSLLQKTIQDNGLI 95 Query: 9 SHF 1 S+F Sbjct: 96 SYF 98 >ref|XP_007216273.1| hypothetical protein PRUPE_ppa017372mg, partial [Prunus persica] gi|462412423|gb|EMJ17472.1| hypothetical protein PRUPE_ppa017372mg, partial [Prunus persica] Length = 601 Score = 67.8 bits (164), Expect = 3e-09 Identities = 37/60 (61%), Positives = 46/60 (76%), Gaps = 2/60 (3%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQE--QGLFSH 4 LQ I +S+ +SNPLY+FLP+TQNPNN+VNLICSSLKQ NAHL++LQ + LF H Sbjct: 10 LQTIPDSHSIS--VSNPLYHFLPQTQNPNNIVNLICSSLKQ-GNAHLSLLQNDIKELFPH 66 >ref|XP_009783577.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Nicotiana sylvestris] gi|698469466|ref|XP_009783578.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Nicotiana sylvestris] gi|698469480|ref|XP_009783579.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Nicotiana sylvestris] gi|698469484|ref|XP_009783580.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Nicotiana sylvestris] Length = 634 Score = 67.4 bits (163), Expect = 4e-09 Identities = 32/52 (61%), Positives = 42/52 (80%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQE 22 LQ +T +N ++ I SN L+NFLPETQNP N+V+LICS+LK KNN HL +LQ+ Sbjct: 39 LQTLTVNNGSRPI-SNSLHNFLPETQNPQNIVSLICSALKNKNNGHLVLLQK 89 >ref|XP_009606050.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Nicotiana tomentosiformis] gi|697104506|ref|XP_009606051.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Nicotiana tomentosiformis] gi|697104510|ref|XP_009606052.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Nicotiana tomentosiformis] gi|697104512|ref|XP_009606053.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Nicotiana tomentosiformis] gi|697104514|ref|XP_009606054.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Nicotiana tomentosiformis] gi|697104516|ref|XP_009606055.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Nicotiana tomentosiformis] gi|697104518|ref|XP_009606056.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Nicotiana tomentosiformis] Length = 630 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/49 (63%), Positives = 39/49 (79%), Gaps = 4/49 (8%) Frame = -1 Query: 138 LSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQE----QGLFSH 4 +SNPL+NFLPETQNP N+V+LICS+LK KNN HL +LQ+ GL S+ Sbjct: 47 ISNPLHNFLPETQNPQNIVSLICSALKSKNNGHLVLLQKTIENHGLISY 95 >ref|XP_006446568.1| hypothetical protein CICLE_v10018361mg, partial [Citrus clementina] gi|557549179|gb|ESR59808.1| hypothetical protein CICLE_v10018361mg, partial [Citrus clementina] Length = 603 Score = 64.3 bits (155), Expect = 3e-08 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQE 22 LQ I +S K LSNPLYNFLPETQNPN +V+LICSSLK K ++HL +LQ+ Sbjct: 15 LQIIQDSEH--KSLSNPLYNFLPETQNPNKIVDLICSSLK-KGDSHLTLLQD 63 >ref|XP_011011828.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Populus euphratica] Length = 626 Score = 63.9 bits (154), Expect = 4e-08 Identities = 37/61 (60%), Positives = 41/61 (67%), Gaps = 3/61 (4%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQE---QGLFS 7 LQ I SN LSNPLYNFLPE QNPNN VNLI SSLK ++N HL +LQ +GL Sbjct: 36 LQTIQNSNSIS--LSNPLYNFLPENQNPNNFVNLIYSSLK-RDNTHLTLLQNDDIKGLIH 92 Query: 6 H 4 H Sbjct: 93 H 93 >ref|XP_008365381.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like [Malus domestica] Length = 639 Score = 63.9 bits (154), Expect = 4e-08 Identities = 36/60 (60%), Positives = 42/60 (70%), Gaps = 2/60 (3%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQE--QGLFSH 4 LQ I +S K +SNPLY+FLP+TQNPNN VNLICSS KQ HLA+LQ +GL H Sbjct: 47 LQTIPDS--PSKSISNPLYHFLPQTQNPNNTVNLICSSFKQ-GKPHLALLQNDIKGLLPH 103 >gb|KDO55175.1| hypothetical protein CISIN_1g037911mg, partial [Citrus sinensis] Length = 609 Score = 63.5 bits (153), Expect = 5e-08 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQ 25 LQ I +S K LSNPLYNFLPETQNPN +V+LICSSLK K ++HL +LQ Sbjct: 33 LQIIQDSEH--KSLSNPLYNFLPETQNPNKIVDLICSSLK-KGDSHLTLLQ 80 >ref|XP_006470265.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X1 [Citrus sinensis] gi|568832069|ref|XP_006470266.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400-like isoform X2 [Citrus sinensis] Length = 621 Score = 63.5 bits (153), Expect = 5e-08 Identities = 34/51 (66%), Positives = 40/51 (78%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQ 25 LQ I +S K LSNPLYNFLPETQNPN +V+LICSSLK K ++HL +LQ Sbjct: 33 LQIIQDSEH--KSLSNPLYNFLPETQNPNKIVDLICSSLK-KGDSHLTLLQ 80 >ref|XP_009334116.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Pyrus x bretschneideri] Length = 638 Score = 63.2 bits (152), Expect = 7e-08 Identities = 36/60 (60%), Positives = 43/60 (71%), Gaps = 2/60 (3%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQE--QGLFSH 4 LQ I +S K +SNPLY+FLP+TQNPNN V+LICSSLKQ HLA+LQ +GL H Sbjct: 46 LQTIPDS--PSKPISNPLYHFLPQTQNPNNTVDLICSSLKQ-GKPHLALLQNDIKGLLPH 102 >ref|XP_012072391.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Jatropha curcas] gi|643740839|gb|KDP46429.1| hypothetical protein JCGZ_10269 [Jatropha curcas] Length = 634 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 2/54 (3%) Frame = -1 Query: 159 SNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQE--QGLFSH 4 SN + K LSNPLY+ LP TQNPNN+VN+I S LKQ +N LAILQ +GL +H Sbjct: 47 SNPSSKSLSNPLYHLLPRTQNPNNIVNIIYSFLKQ-DNTQLAILQNDIKGLLAH 99 >ref|XP_002521455.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223539354|gb|EEF40945.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 623 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 2/53 (3%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQ--KNNAHLAILQ 25 L I +SN + LSNPLY+ LP+TQNPNN+VN++ SSLKQ NN+HL +LQ Sbjct: 29 LLAIPDSNS--RSLSNPLYHLLPQTQNPNNIVNIVYSSLKQHNNNNSHLNLLQ 79 >emb|CAN65388.1| hypothetical protein VITISV_038361 [Vitis vinifera] Length = 676 Score = 59.3 bits (142), Expect = 1e-06 Identities = 36/86 (41%), Positives = 51/86 (59%) Frame = -1 Query: 276 IRKLKSINYLPPVSTPIFTNIFQXXXXXXXXXSLQKITESNETKKILSNPLYNFLPETQN 97 I +K Y P+S P+ IF S + ++T I SN LY+ LP+TQN Sbjct: 52 IHAIKLNLYKYPLSLPVLRFIFIPKFPYSSSSSSLQTLNQSQTNSI-SNSLYHLLPQTQN 110 Query: 96 PNNLVNLICSSLKQKNNAHLAILQEQ 19 PNN+VNLICS+LKQ +N++LA+L + Sbjct: 111 PNNIVNLICSNLKQ-HNSNLALLHTE 135 >ref|XP_002324003.1| hypothetical protein POPTR_0017s10790g [Populus trichocarpa] gi|222867005|gb|EEF04136.1| hypothetical protein POPTR_0017s10790g [Populus trichocarpa] Length = 626 Score = 58.9 bits (141), Expect = 1e-06 Identities = 35/61 (57%), Positives = 40/61 (65%), Gaps = 3/61 (4%) Frame = -1 Query: 177 LQKITESNETKKILSNPLYNFLPETQNPNNLVNLICSSLKQKNNAHLAILQE---QGLFS 7 LQ I SN LSNPLY+FLPE QNPNN VNLI SSLK ++N L +LQ +GL Sbjct: 36 LQTIQNSNSIS--LSNPLYSFLPENQNPNNFVNLIYSSLK-RDNTQLTLLQNDDIKGLIH 92 Query: 6 H 4 H Sbjct: 93 H 93 >ref|XP_010690025.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Beta vulgaris subsp. vulgaris] gi|731357099|ref|XP_010690026.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Beta vulgaris subsp. vulgaris] gi|731357101|ref|XP_010690027.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Beta vulgaris subsp. vulgaris] gi|731357103|ref|XP_010690028.1| PREDICTED: pentatricopeptide repeat-containing protein At5g40400 [Beta vulgaris subsp. vulgaris] gi|870849407|gb|KMT01655.1| hypothetical protein BVRB_9g211160 [Beta vulgaris subsp. vulgaris] Length = 628 Score = 56.6 bits (135), Expect = 6e-06 Identities = 30/48 (62%), Positives = 33/48 (68%), Gaps = 1/48 (2%) Frame = -1 Query: 144 KILSNPLYNFLPETQNPNNLVNLICSSLKQKN-NAHLAILQEQGLFSH 4 K + NPLY+FLPETQNP NLVNLICS+LKQ N L Q Q L H Sbjct: 44 KPILNPLYSFLPETQNPKNLVNLICSALKQPNFQTKLLSNQLQDLIPH 91