BLASTX nr result
ID: Forsythia23_contig00034070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00034070 (355 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088071.1| PREDICTED: microtubule-associated protein fu... 61 3e-07 >ref|XP_011088071.1| PREDICTED: microtubule-associated protein futsch [Sesamum indicum] Length = 655 Score = 60.8 bits (146), Expect = 3e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = -3 Query: 326 NTKDGFRGGSYNLEDSANEAYGRVRNKIYGILMKHVERTAM 204 N ++G RGG LEDS EAY RVRNKIYGIL+KHVERTAM Sbjct: 606 NPQEGGRGGCAYLEDSEAEAYRRVRNKIYGILLKHVERTAM 646