BLASTX nr result
ID: Forsythia23_contig00033995
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00033995 (395 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012848098.1| PREDICTED: random slug protein 5 [Erythranth... 63 9e-08 ref|XP_011086892.1| PREDICTED: random slug protein 5-like [Sesam... 58 3e-06 >ref|XP_012848098.1| PREDICTED: random slug protein 5 [Erythranthe guttatus] gi|604315913|gb|EYU28478.1| hypothetical protein MIMGU_mgv1a012076mg [Erythranthe guttata] Length = 262 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +3 Query: 3 KLFMQGHDNTGRPIVLVFAERHKPTSVEEFKR 98 KLFMQG+D TGRPIVLVFAERHKPT+V+EFKR Sbjct: 109 KLFMQGYDKTGRPIVLVFAERHKPTTVDEFKR 140 >ref|XP_011086892.1| PREDICTED: random slug protein 5-like [Sesamum indicum] Length = 262 Score = 57.8 bits (138), Expect = 3e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = +3 Query: 3 KLFMQGHDNTGRPIVLVFAERHKPTSVEEFKR 98 KLFMQG+D +GRPIV+VFA +HKPT+VEEFKR Sbjct: 109 KLFMQGYDKSGRPIVVVFAAKHKPTNVEEFKR 140