BLASTX nr result
ID: Forsythia23_contig00033880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00033880 (350 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009602054.1| PREDICTED: putative phagocytic receptor 1b [... 119 8e-25 ref|XP_009775043.1| PREDICTED: putative phagocytic receptor 1b [... 117 4e-24 ref|XP_011099916.1| PREDICTED: transmembrane 9 superfamily membe... 114 3e-23 ref|XP_012845085.1| PREDICTED: transmembrane 9 superfamily membe... 114 3e-23 ref|XP_009616336.1| PREDICTED: putative phagocytic receptor 1b [... 112 1e-22 ref|XP_012845078.1| PREDICTED: transmembrane 9 superfamily membe... 111 2e-22 ref|XP_009774478.1| PREDICTED: putative phagocytic receptor 1b [... 109 8e-22 ref|XP_006346764.1| PREDICTED: putative phagocytic receptor 1b-l... 109 8e-22 ref|XP_004236681.1| PREDICTED: putative phagocytic receptor 1b [... 109 8e-22 ref|XP_010276303.1| PREDICTED: putative phagocytic receptor 1b [... 108 1e-21 ref|XP_008461818.1| PREDICTED: putative phagocytic receptor 1b i... 107 2e-21 ref|XP_004137376.1| PREDICTED: transmembrane 9 superfamily membe... 107 2e-21 ref|XP_010244840.1| PREDICTED: putative phagocytic receptor 1b [... 106 7e-21 ref|XP_002521900.1| transporter, putative [Ricinus communis] gi|... 106 7e-21 ref|XP_004239834.1| PREDICTED: putative phagocytic receptor 1b [... 104 3e-20 ref|XP_010691703.1| PREDICTED: transmembrane 9 superfamily membe... 103 6e-20 ref|XP_010069472.1| PREDICTED: putative phagocytic receptor 1b [... 103 6e-20 ref|XP_010691704.1| PREDICTED: transmembrane 9 superfamily membe... 102 8e-20 ref|XP_012072397.1| PREDICTED: transmembrane 9 superfamily membe... 102 8e-20 gb|KJB15313.1| hypothetical protein B456_002G170500 [Gossypium r... 102 1e-19 >ref|XP_009602054.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis] Length = 594 Score = 119 bits (298), Expect = 8e-25 Identities = 55/74 (74%), Positives = 60/74 (81%) Frame = +1 Query: 127 MAEKKEIMVMMRWYAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYR 306 M +KK M WY VVL++V A PVRSD SDH+YK GDPVPLYANKVGPFHNPSETYR Sbjct: 1 MEKKKRTMA---WYVVVLLIVSCASPVRSDGSDHKYKAGDPVPLYANKVGPFHNPSETYR 57 Query: 307 YLDLPFCAPAHVKE 348 + DLPFCAPAHVKE Sbjct: 58 FFDLPFCAPAHVKE 71 >ref|XP_009775043.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris] Length = 593 Score = 117 bits (292), Expect = 4e-24 Identities = 54/72 (75%), Positives = 58/72 (80%) Frame = +1 Query: 133 EKKEIMVMMRWYAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYL 312 EKK M WY VVL++V A PVRSD SDH+YK GDPVPLYANKVGPFHNPSETYR+ Sbjct: 2 EKKRTMA---WYVVVLLIVSCASPVRSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRFF 58 Query: 313 DLPFCAPAHVKE 348 DLPFCAP HVKE Sbjct: 59 DLPFCAPDHVKE 70 >ref|XP_011099916.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum] gi|747103450|ref|XP_011099917.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum] gi|747103452|ref|XP_011099918.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum] gi|747103454|ref|XP_011099919.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum] Length = 592 Score = 114 bits (284), Expect = 3e-23 Identities = 49/62 (79%), Positives = 56/62 (90%) Frame = +1 Query: 163 WYAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCAPAHV 342 W+ +VL+LVCTAI VRSDASDH+YK+GD VPLYANKVGPFHNPSETYRY DLPFC+P V Sbjct: 8 WHVMVLLLVCTAIRVRSDASDHKYKIGDAVPLYANKVGPFHNPSETYRYFDLPFCSPGDV 67 Query: 343 KE 348 K+ Sbjct: 68 KD 69 >ref|XP_012845085.1| PREDICTED: transmembrane 9 superfamily member 3 [Erythranthe guttatus] gi|604319728|gb|EYU30892.1| hypothetical protein MIMGU_mgv1a003326mg [Erythranthe guttata] Length = 592 Score = 114 bits (284), Expect = 3e-23 Identities = 50/63 (79%), Positives = 58/63 (92%), Gaps = 1/63 (1%) Frame = +1 Query: 163 WYAVVLVLVCTAIP-VRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCAPAH 339 W+ VVL+L+CTA P VRSDASDH++KVGDPVPLYANKVGPFHNPSETYRY DLPFC+P + Sbjct: 7 WHVVVLLLLCTAFPAVRSDASDHKFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPGN 66 Query: 340 VKE 348 VK+ Sbjct: 67 VKD 69 >ref|XP_009616336.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis] Length = 593 Score = 112 bits (279), Expect = 1e-22 Identities = 47/61 (77%), Positives = 53/61 (86%) Frame = +1 Query: 166 YAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCAPAHVK 345 Y VVL+++C +P RSD SDH+YK GD VPLYANKVGPFHNPSETYR+ DLPFCAPAHVK Sbjct: 10 YVVVLIMLCCVLPARSDGSDHKYKAGDSVPLYANKVGPFHNPSETYRFFDLPFCAPAHVK 69 Query: 346 E 348 E Sbjct: 70 E 70 >ref|XP_012845078.1| PREDICTED: transmembrane 9 superfamily member 3-like [Erythranthe guttatus] gi|604319714|gb|EYU30878.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata] gi|604319715|gb|EYU30879.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata] Length = 592 Score = 111 bits (278), Expect = 2e-22 Identities = 50/63 (79%), Positives = 55/63 (87%), Gaps = 1/63 (1%) Frame = +1 Query: 163 WYAVVLVLVCTAIPV-RSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCAPAH 339 W AVVL+L+CTA P RSD SDH+YKVGDPVPLYANKVGPFHNPSETYRY DLPFC+P Sbjct: 7 WRAVVLLLLCTAFPAARSDGSDHKYKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPGD 66 Query: 340 VKE 348 VK+ Sbjct: 67 VKD 69 >ref|XP_009774478.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris] Length = 593 Score = 109 bits (272), Expect = 8e-22 Identities = 45/61 (73%), Positives = 52/61 (85%) Frame = +1 Query: 166 YAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCAPAHVK 345 Y +VL+++ +P RSD SDH+YK GDPVPLYANKVGPFHNPSETYR+ DLPFCAPAH K Sbjct: 10 YVIVLIILSCVLPARSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRFFDLPFCAPAHAK 69 Query: 346 E 348 E Sbjct: 70 E 70 >ref|XP_006346764.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum] Length = 598 Score = 109 bits (272), Expect = 8e-22 Identities = 50/76 (65%), Positives = 58/76 (76%) Frame = +1 Query: 121 TKMAEKKEIMVMMRWYAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSET 300 TK ++ E M + Y VVL+++C A P RSD SDH+YK GD VPLYANKVGPFHNPSET Sbjct: 3 TKFVKEMEKMAL---YVVVLLIICYASPARSDGSDHKYKSGDQVPLYANKVGPFHNPSET 59 Query: 301 YRYLDLPFCAPAHVKE 348 YR+ DLPFC P HVKE Sbjct: 60 YRFFDLPFCTPDHVKE 75 >ref|XP_004236681.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum] Length = 598 Score = 109 bits (272), Expect = 8e-22 Identities = 50/76 (65%), Positives = 58/76 (76%) Frame = +1 Query: 121 TKMAEKKEIMVMMRWYAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSET 300 TK ++ E M + Y VVL+++C A P RSD SDH+YK GD VPLYANKVGPFHNPSET Sbjct: 3 TKFVKEMEKMAL---YVVVLLIICYASPARSDGSDHKYKSGDQVPLYANKVGPFHNPSET 59 Query: 301 YRYLDLPFCAPAHVKE 348 YR+ DLPFC P HVKE Sbjct: 60 YRFFDLPFCTPDHVKE 75 >ref|XP_010276303.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera] Length = 592 Score = 108 bits (270), Expect = 1e-21 Identities = 48/66 (72%), Positives = 54/66 (81%) Frame = +1 Query: 151 VMMRWYAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCA 330 VM V+L+++C+ VRSDASDHRYK GDPVPLYANKVGPFHNPSETYRY DLPFC+ Sbjct: 4 VMASSLVVLLLILCSGSQVRSDASDHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFCS 63 Query: 331 PAHVKE 348 P HV E Sbjct: 64 PGHVTE 69 >ref|XP_008461818.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Cucumis melo] Length = 591 Score = 107 bits (268), Expect = 2e-21 Identities = 47/61 (77%), Positives = 52/61 (85%) Frame = +1 Query: 166 YAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCAPAHVK 345 + +LVL+C ++PVRSD SDHRYK GDPVPLYANKVGPFHNPSETYRY DLPFC P VK Sbjct: 9 FIALLVLLCGSVPVRSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDDVK 68 Query: 346 E 348 E Sbjct: 69 E 69 >ref|XP_004137376.1| PREDICTED: transmembrane 9 superfamily member 3 [Cucumis sativus] gi|700208837|gb|KGN63933.1| hypothetical protein Csa_1G029600 [Cucumis sativus] Length = 591 Score = 107 bits (268), Expect = 2e-21 Identities = 47/61 (77%), Positives = 52/61 (85%) Frame = +1 Query: 166 YAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCAPAHVK 345 + +LVL+C ++PVRSD SDHRYK GDPVPLYANKVGPFHNPSETYRY DLPFC P VK Sbjct: 9 FIALLVLLCGSVPVRSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDDVK 68 Query: 346 E 348 E Sbjct: 69 E 69 >ref|XP_010244840.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera] gi|719962825|ref|XP_010244916.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera] Length = 592 Score = 106 bits (264), Expect = 7e-21 Identities = 49/66 (74%), Positives = 51/66 (77%) Frame = +1 Query: 151 VMMRWYAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCA 330 VM V L+ C VRSDASDHRYK GDPVPLYANKVGPFHNPSETYRY DLPFC+ Sbjct: 4 VMASSLLVALLFFCWGNQVRSDASDHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFCS 63 Query: 331 PAHVKE 348 PAHV E Sbjct: 64 PAHVTE 69 >ref|XP_002521900.1| transporter, putative [Ricinus communis] gi|223538938|gb|EEF40536.1| transporter, putative [Ricinus communis] Length = 588 Score = 106 bits (264), Expect = 7e-21 Identities = 46/58 (79%), Positives = 50/58 (86%) Frame = +1 Query: 175 VLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCAPAHVKE 348 VL++ C+ VRSDASDHRYK GDPVPLYANKVGPFHNPSETYRY DLPFC P H+KE Sbjct: 14 VLIIACSVTHVRSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHLKE 71 >ref|XP_004239834.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum] Length = 597 Score = 104 bits (259), Expect = 3e-20 Identities = 49/76 (64%), Positives = 55/76 (72%) Frame = +1 Query: 121 TKMAEKKEIMVMMRWYAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSET 300 T EKK MM + V++VL C P RSD SDH+YK GD V +YANKVGPFHNPSET Sbjct: 3 TTEMEKK----MMSYVVVLIVLCCGVTPARSDGSDHKYKAGDQVTMYANKVGPFHNPSET 58 Query: 301 YRYLDLPFCAPAHVKE 348 YR+ DLPFCAPAHV E Sbjct: 59 YRFFDLPFCAPAHVTE 74 >ref|XP_010691703.1| PREDICTED: transmembrane 9 superfamily member 2 [Beta vulgaris subsp. vulgaris] gi|870848864|gb|KMT01153.1| hypothetical protein BVRB_9g224040 [Beta vulgaris subsp. vulgaris] Length = 592 Score = 103 bits (256), Expect = 6e-20 Identities = 49/72 (68%), Positives = 55/72 (76%) Frame = +1 Query: 133 EKKEIMVMMRWYAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYL 312 EK M+M+ V+ L + + VRSDASDHRYK G+ VPLYANKVGPFHNPSETYRY Sbjct: 2 EKSTAMLMV----AVVFLFSSVVQVRSDASDHRYKAGEAVPLYANKVGPFHNPSETYRYF 57 Query: 313 DLPFCAPAHVKE 348 DLPFCAP HVKE Sbjct: 58 DLPFCAPDHVKE 69 >ref|XP_010069472.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis] gi|629091840|gb|KCW57835.1| hypothetical protein EUGRSUZ_H00588 [Eucalyptus grandis] Length = 590 Score = 103 bits (256), Expect = 6e-20 Identities = 45/60 (75%), Positives = 49/60 (81%) Frame = +1 Query: 169 AVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCAPAHVKE 348 AV +++ P RSD SDHRYK GDPVPLYANKVGPFHNPSETYRY DLPFC PAH+KE Sbjct: 9 AVAVLMASLCSPARSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCIPAHLKE 68 >ref|XP_010691704.1| PREDICTED: transmembrane 9 superfamily member 3-like [Beta vulgaris subsp. vulgaris] gi|870848866|gb|KMT01155.1| hypothetical protein BVRB_9g224060 [Beta vulgaris subsp. vulgaris] Length = 593 Score = 102 bits (255), Expect = 8e-20 Identities = 49/72 (68%), Positives = 55/72 (76%) Frame = +1 Query: 133 EKKEIMVMMRWYAVVLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYL 312 EK +M+ A+V++L I VRSDASDHRYK G+ VPLYANKVGPFHNPSETYRY Sbjct: 2 EKSRATLMV---AIVIMLFSGVIQVRSDASDHRYKAGEAVPLYANKVGPFHNPSETYRYF 58 Query: 313 DLPFCAPAHVKE 348 DLPFC P HVKE Sbjct: 59 DLPFCIPDHVKE 70 >ref|XP_012072397.1| PREDICTED: transmembrane 9 superfamily member 2 [Jatropha curcas] gi|643730759|gb|KDP38191.1| hypothetical protein JCGZ_04834 [Jatropha curcas] Length = 591 Score = 102 bits (255), Expect = 8e-20 Identities = 45/58 (77%), Positives = 48/58 (82%) Frame = +1 Query: 175 VLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCAPAHVKE 348 V+ + C VRSDASDHRYK GDPVPLYANKVGPFHNPSETYRY DLPFC P H+KE Sbjct: 11 VVAIACFVTHVRSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHLKE 68 >gb|KJB15313.1| hypothetical protein B456_002G170500 [Gossypium raimondii] Length = 560 Score = 102 bits (254), Expect = 1e-19 Identities = 47/58 (81%), Positives = 50/58 (86%) Frame = +1 Query: 175 VLVLVCTAIPVRSDASDHRYKVGDPVPLYANKVGPFHNPSETYRYLDLPFCAPAHVKE 348 V +L C + VRSDASDHRYK GDPVPLYANKVGPFHNPSETYRY DLPFC+P HVKE Sbjct: 15 VFILSCVS-HVRSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKE 71