BLASTX nr result
ID: Forsythia23_contig00033454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00033454 (335 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089406.1| PREDICTED: nudix hydrolase 9 isoform X2 [Ses... 63 9e-08 ref|XP_011089405.1| PREDICTED: nudix hydrolase 9 isoform X1 [Ses... 63 9e-08 emb|CDP08982.1| unnamed protein product [Coffea canephora] 61 3e-07 ref|XP_010313546.1| PREDICTED: nudix hydrolase 9 isoform X3 [Sol... 59 1e-06 ref|XP_010313545.1| PREDICTED: nudix hydrolase 9 isoform X2 [Sol... 59 1e-06 ref|XP_006363353.1| PREDICTED: nudix hydrolase 9-like isoform X2... 59 1e-06 ref|XP_006363352.1| PREDICTED: nudix hydrolase 9-like isoform X1... 59 1e-06 ref|XP_004251300.1| PREDICTED: nudix hydrolase 9 isoform X1 [Sol... 59 1e-06 ref|XP_010937737.1| PREDICTED: nudix hydrolase 9 isoform X7 [Ela... 59 1e-06 ref|XP_010937736.1| PREDICTED: nudix hydrolase 9 isoform X6 [Ela... 59 1e-06 ref|XP_010937734.1| PREDICTED: nudix hydrolase 9 isoform X5 [Ela... 59 1e-06 ref|XP_010937733.1| PREDICTED: nudix hydrolase 9 isoform X4 [Ela... 59 1e-06 ref|XP_010937732.1| PREDICTED: nudix hydrolase 9 isoform X3 [Ela... 59 1e-06 ref|XP_010937730.1| PREDICTED: nudix hydrolase 9 isoform X1 [Ela... 59 1e-06 ref|XP_012827807.1| PREDICTED: nudix hydrolase 9 [Erythranthe gu... 59 1e-06 ref|XP_010651072.1| PREDICTED: nudix hydrolase 9 isoform X3 [Vit... 59 2e-06 ref|XP_010651071.1| PREDICTED: nudix hydrolase 9 isoform X1 [Vit... 59 2e-06 ref|XP_010253363.1| PREDICTED: nudix hydrolase 9 [Nelumbo nucife... 59 2e-06 ref|XP_002284515.1| PREDICTED: nudix hydrolase 9 isoform X2 [Vit... 59 2e-06 gb|EPS62877.1| hypothetical protein M569_11911, partial [Genlise... 59 2e-06 >ref|XP_011089406.1| PREDICTED: nudix hydrolase 9 isoform X2 [Sesamum indicum] Length = 258 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWERFL PSED+ RRCQH Sbjct: 101 LTDYRTFVGTNLNPLWERFLIPSEDDWRRCQH 132 >ref|XP_011089405.1| PREDICTED: nudix hydrolase 9 isoform X1 [Sesamum indicum] Length = 305 Score = 62.8 bits (151), Expect = 9e-08 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWERFL PSED+ RRCQH Sbjct: 101 LTDYRTFVGTNLNPLWERFLIPSEDDWRRCQH 132 >emb|CDP08982.1| unnamed protein product [Coffea canephora] Length = 297 Score = 61.2 bits (147), Expect = 3e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWERFL PSED+ R+CQH Sbjct: 93 LTDYRTFVGTNLNPLWERFLLPSEDDFRQCQH 124 >ref|XP_010313546.1| PREDICTED: nudix hydrolase 9 isoform X3 [Solanum lycopersicum] Length = 288 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNL+P+WERFL PSED+C +CQH Sbjct: 70 LTDYRTFVGTNLSPMWERFLVPSEDDCIQCQH 101 >ref|XP_010313545.1| PREDICTED: nudix hydrolase 9 isoform X2 [Solanum lycopersicum] Length = 294 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNL+P+WERFL PSED+C +CQH Sbjct: 76 LTDYRTFVGTNLSPMWERFLVPSEDDCIQCQH 107 >ref|XP_006363353.1| PREDICTED: nudix hydrolase 9-like isoform X2 [Solanum tuberosum] Length = 247 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNL+P+WERFL PSED+C +CQH Sbjct: 95 LTDYRTFVGTNLSPMWERFLVPSEDDCIQCQH 126 >ref|XP_006363352.1| PREDICTED: nudix hydrolase 9-like isoform X1 [Solanum tuberosum] Length = 300 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNL+P+WERFL PSED+C +CQH Sbjct: 95 LTDYRTFVGTNLSPMWERFLVPSEDDCIQCQH 126 >ref|XP_004251300.1| PREDICTED: nudix hydrolase 9 isoform X1 [Solanum lycopersicum] Length = 313 Score = 59.3 bits (142), Expect = 1e-06 Identities = 24/32 (75%), Positives = 28/32 (87%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNL+P+WERFL PSED+C +CQH Sbjct: 95 LTDYRTFVGTNLSPMWERFLVPSEDDCIQCQH 126 >ref|XP_010937737.1| PREDICTED: nudix hydrolase 9 isoform X7 [Elaeis guineensis] Length = 258 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWE+FL PSED+ RCQH Sbjct: 46 LTDYRTFVGTNLNPLWEKFLIPSEDDSVRCQH 77 >ref|XP_010937736.1| PREDICTED: nudix hydrolase 9 isoform X6 [Elaeis guineensis] Length = 273 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWE+FL PSED+ RCQH Sbjct: 61 LTDYRTFVGTNLNPLWEKFLIPSEDDSVRCQH 92 >ref|XP_010937734.1| PREDICTED: nudix hydrolase 9 isoform X5 [Elaeis guineensis] Length = 286 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWE+FL PSED+ RCQH Sbjct: 74 LTDYRTFVGTNLNPLWEKFLIPSEDDSVRCQH 105 >ref|XP_010937733.1| PREDICTED: nudix hydrolase 9 isoform X4 [Elaeis guineensis] Length = 290 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWE+FL PSED+ RCQH Sbjct: 78 LTDYRTFVGTNLNPLWEKFLIPSEDDSVRCQH 109 >ref|XP_010937732.1| PREDICTED: nudix hydrolase 9 isoform X3 [Elaeis guineensis] Length = 301 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWE+FL PSED+ RCQH Sbjct: 103 LTDYRTFVGTNLNPLWEKFLIPSEDDSVRCQH 134 >ref|XP_010937730.1| PREDICTED: nudix hydrolase 9 isoform X1 [Elaeis guineensis] Length = 315 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWE+FL PSED+ RCQH Sbjct: 103 LTDYRTFVGTNLNPLWEKFLIPSEDDSVRCQH 134 >ref|XP_012827807.1| PREDICTED: nudix hydrolase 9 [Erythranthe guttatus] gi|604298947|gb|EYU18917.1| hypothetical protein MIMGU_mgv1a010296mg [Erythranthe guttata] Length = 316 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/55 (54%), Positives = 36/55 (65%) Frame = -1 Query: 167 PCKGKE*LLLPEARLKERLESRILADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 PC G + P + + L+ L D RTFVGTNLNP+WERFL PSED+ RCQH Sbjct: 94 PCSGLD----PSQKTRVCLQLG-LTDYRTFVGTNLNPMWERFLVPSEDDWIRCQH 143 >ref|XP_010651072.1| PREDICTED: nudix hydrolase 9 isoform X3 [Vitis vinifera] Length = 244 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWE+FL PSED+ RCQH Sbjct: 107 LTDYRTFVGTNLNPLWEKFLVPSEDDSVRCQH 138 >ref|XP_010651071.1| PREDICTED: nudix hydrolase 9 isoform X1 [Vitis vinifera] Length = 311 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWE+FL PSED+ RCQH Sbjct: 107 LTDYRTFVGTNLNPLWEKFLVPSEDDSVRCQH 138 >ref|XP_010253363.1| PREDICTED: nudix hydrolase 9 [Nelumbo nucifera] gi|719991792|ref|XP_010253364.1| PREDICTED: nudix hydrolase 9 [Nelumbo nucifera] gi|719991799|ref|XP_010253365.1| PREDICTED: nudix hydrolase 9 [Nelumbo nucifera] gi|719991804|ref|XP_010253366.1| PREDICTED: nudix hydrolase 9 [Nelumbo nucifera] gi|719991807|ref|XP_010253367.1| PREDICTED: nudix hydrolase 9 [Nelumbo nucifera] Length = 303 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWE+FL PSED+ RCQH Sbjct: 99 LTDYRTFVGTNLNPLWEKFLVPSEDDSIRCQH 130 >ref|XP_002284515.1| PREDICTED: nudix hydrolase 9 isoform X2 [Vitis vinifera] Length = 301 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWE+FL PSED+ RCQH Sbjct: 97 LTDYRTFVGTNLNPLWEKFLVPSEDDSVRCQH 128 >gb|EPS62877.1| hypothetical protein M569_11911, partial [Genlisea aurea] Length = 289 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -1 Query: 98 LADLRTFVGTNLNPLWERFLFPSEDNCRRCQH 3 L D RTFVGTNLNPLWE+FL PS D+ RRCQH Sbjct: 89 LTDYRTFVGTNLNPLWEKFLVPSTDDRRRCQH 120