BLASTX nr result
ID: Forsythia23_contig00033451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00033451 (527 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009801370.1| PREDICTED: transcription factor BIM2-like [N... 59 2e-06 ref|XP_009594724.1| PREDICTED: transcription factor BIM2 [Nicoti... 57 5e-06 >ref|XP_009801370.1| PREDICTED: transcription factor BIM2-like [Nicotiana sylvestris] gi|698512731|ref|XP_009801371.1| PREDICTED: transcription factor BIM2-like [Nicotiana sylvestris] Length = 302 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/40 (62%), Positives = 32/40 (80%) Frame = -3 Query: 120 RSNSVPVESFIDQSHLARNGTVHEDNYIVNPTLLSHAQNS 1 RS S PVE F++QS + RNG+ HEDN ++NPTLL+ AQNS Sbjct: 115 RSTSGPVEGFVEQSQIIRNGSTHEDNIVINPTLLTSAQNS 154 >ref|XP_009594724.1| PREDICTED: transcription factor BIM2 [Nicotiana tomentosiformis] gi|697171593|ref|XP_009594725.1| PREDICTED: transcription factor BIM2 [Nicotiana tomentosiformis] gi|697171595|ref|XP_009594726.1| PREDICTED: transcription factor BIM2 [Nicotiana tomentosiformis] Length = 311 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/40 (60%), Positives = 31/40 (77%) Frame = -3 Query: 120 RSNSVPVESFIDQSHLARNGTVHEDNYIVNPTLLSHAQNS 1 R S PVE F++QS + RNG+ HEDN ++NPTLL+ AQNS Sbjct: 115 RGTSGPVEGFVEQSQIIRNGSTHEDNIVINPTLLTSAQNS 154