BLASTX nr result
ID: Forsythia23_contig00033422
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00033422 (442 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085121.1| PREDICTED: uncharacterized protein LOC105167... 58 2e-06 >ref|XP_011085121.1| PREDICTED: uncharacterized protein LOC105167197 [Sesamum indicum] Length = 711 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -3 Query: 440 GLQARKSEEIPFPGPDSSNNAAFECNIPEDTNIDEANNQ 324 GLQARKSEEI F PD SN+AA ECN+ ED +IDE+N Q Sbjct: 673 GLQARKSEEISFQTPDPSNSAALECNVLEDASIDESNKQ 711