BLASTX nr result
ID: Forsythia23_contig00033328
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00033328 (300 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS61778.1| hypothetical protein M569_13015, partial [Genlise... 60 7e-07 >gb|EPS61778.1| hypothetical protein M569_13015, partial [Genlisea aurea] Length = 84 Score = 59.7 bits (143), Expect = 7e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 299 SPRIQRSMSQAQQNAKGNETQSPQDRKWRR 210 SPRIQRS+SQAQQN KGN TQSPQDRKWRR Sbjct: 55 SPRIQRSLSQAQQNGKGNGTQSPQDRKWRR 84