BLASTX nr result
ID: Forsythia23_contig00033169
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00033169 (1167 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010096055.1| hypothetical protein L484_008711 [Morus nota... 70 4e-09 ref|XP_010096057.1| hypothetical protein L484_008713 [Morus nota... 63 4e-07 >ref|XP_010096055.1| hypothetical protein L484_008711 [Morus notabilis] gi|587873685|gb|EXB62861.1| hypothetical protein L484_008711 [Morus notabilis] Length = 160 Score = 69.7 bits (169), Expect = 4e-09 Identities = 33/88 (37%), Positives = 49/88 (55%) Frame = -2 Query: 548 DFTKIRDKYRVSEGVRLIFSAMLDRPCDPSKGHVAVMSDAFECGMRLPLHKFFRAILWSY 369 D R K+ + GVRL + +D P P++G + + AFECG+RLP H FFR +L + Sbjct: 20 DIDDSRLKFSIPAGVRLRIPSAVDLPSQPNRGEICLHMLAFECGLRLPFHPFFRTVLAHF 79 Query: 368 NVCPYQMSLNF*TQSVGT*LLWQEVSPD 285 + P Q+SLN G +LW+ S + Sbjct: 80 GLAPTQLSLNVWMHMAGAVILWRICSEE 107 >ref|XP_010096057.1| hypothetical protein L484_008713 [Morus notabilis] gi|587873687|gb|EXB62863.1| hypothetical protein L484_008713 [Morus notabilis] Length = 242 Score = 63.2 bits (152), Expect = 4e-07 Identities = 37/112 (33%), Positives = 57/112 (50%) Frame = -2 Query: 548 DFTKIRDKYRVSEGVRLIFSAMLDRPCDPSKGHVAVMSDAFECGMRLPLHKFFRAILWSY 369 D +R K+ + GVRL ++ D P P G + + + AFE G+RLP H F R +L + Sbjct: 22 DMNNLRLKFNIPAGVRLRIPSVGDLPSCPKPGEIGLYTVAFEYGLRLPFHPFIRTVLAHF 81 Query: 368 NVCPYQMSLNF*TQSVGT*LLWQEVSPDYPMHLYIFQTLFKLNKCAMRDEKP 213 ++ P Q+S N G +LW+ S + H+ TL + N C M +P Sbjct: 82 DLAPTQLSPNVWRHMAGAIILWRICSEEKD-HI----TLDEFNFCYMLRYRP 128