BLASTX nr result
ID: Forsythia23_contig00033118
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00033118 (726 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010088175.1| hypothetical protein L484_004155 [Morus nota... 74 7e-11 >ref|XP_010088175.1| hypothetical protein L484_004155 [Morus notabilis] gi|587841539|gb|EXB32141.1| hypothetical protein L484_004155 [Morus notabilis] Length = 97 Score = 74.3 bits (181), Expect = 7e-11 Identities = 41/58 (70%), Positives = 44/58 (75%), Gaps = 5/58 (8%) Frame = +3 Query: 276 VERENSWDVVGKGGSSFNPNRLNSRL--G*W---*VRKNPFNGGFLLLVPDPLL*TIR 434 VER N WDVVGKGGSSF+PNRLNSRL G W VRKNPF+GGFL LVP PL +R Sbjct: 26 VERANFWDVVGKGGSSFHPNRLNSRLHIGRWKVQQVRKNPFHGGFLQLVPVPLRAVLR 83