BLASTX nr result
ID: Forsythia23_contig00032406
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00032406 (328 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089540.1| PREDICTED: 26S protease regulatory subunit 6... 68 3e-09 ref|XP_011080639.1| PREDICTED: 26S protease regulatory subunit 6... 68 3e-09 ref|XP_010553185.1| PREDICTED: 26S protease regulatory subunit 6... 68 3e-09 ref|XP_010541475.1| PREDICTED: 26S protease regulatory subunit 6... 68 3e-09 ref|XP_009120337.1| PREDICTED: 26S protease regulatory subunit 6... 68 3e-09 ref|XP_009132068.1| PREDICTED: 26S protease regulatory subunit 6... 68 3e-09 emb|CDY02806.1| BnaC02g10830D [Brassica napus] 68 3e-09 ref|XP_009126768.1| PREDICTED: 26S protease regulatory subunit 6... 68 3e-09 emb|CDY32995.1| BnaA10g12010D [Brassica napus] 68 3e-09 emb|CDY58566.1| BnaC03g12460D [Brassica napus] 68 3e-09 emb|CDY43865.1| BnaC09g33780D [Brassica napus] 68 3e-09 emb|CDX88666.1| BnaA03g09830D [Brassica napus] 68 3e-09 gb|KFK27360.1| hypothetical protein AALP_AA8G372700 [Arabis alpina] 68 3e-09 ref|XP_012842684.1| PREDICTED: 26S protease regulatory subunit 6... 68 3e-09 ref|NP_200637.1| regulatory particle triple-A ATPase 3 [Arabidop... 67 6e-09 ref|XP_012486311.1| PREDICTED: 26S protease regulatory subunit 6... 67 6e-09 ref|XP_011040698.1| PREDICTED: 26S protease regulatory subunit 6... 67 6e-09 gb|KHN24721.1| 26S protease regulatory subunit 6B like [Glycine ... 67 6e-09 gb|KHN18648.1| 26S protease regulatory subunit 6B like [Glycine ... 67 6e-09 ref|XP_010684522.1| PREDICTED: 26S protease regulatory subunit 6... 67 6e-09 >ref|XP_011089540.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Sesamum indicum] Length = 416 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 387 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 416 >ref|XP_011080639.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Sesamum indicum] Length = 415 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 386 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 415 >ref|XP_010553185.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Tarenaya hassleriana] Length = 404 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 375 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_010541475.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Tarenaya hassleriana] Length = 405 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 376 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 405 >ref|XP_009120337.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica rapa] Length = 404 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 375 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_009132068.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica rapa] Length = 404 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 375 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >emb|CDY02806.1| BnaC02g10830D [Brassica napus] Length = 404 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 375 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_009126768.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Brassica rapa] gi|674900274|emb|CDY32714.1| BnaA02g07760D [Brassica napus] Length = 404 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 375 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >emb|CDY32995.1| BnaA10g12010D [Brassica napus] Length = 404 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 375 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >emb|CDY58566.1| BnaC03g12460D [Brassica napus] Length = 404 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 375 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >emb|CDY43865.1| BnaC09g33780D [Brassica napus] Length = 404 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 375 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >emb|CDX88666.1| BnaA03g09830D [Brassica napus] Length = 404 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 375 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >gb|KFK27360.1| hypothetical protein AALP_AA8G372700 [Arabis alpina] Length = 404 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 375 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 404 >ref|XP_012842684.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Erythranthe guttatus] gi|604347879|gb|EYU46034.1| hypothetical protein MIMGU_mgv1a007193mg [Erythranthe guttata] Length = 415 Score = 67.8 bits (164), Expect = 3e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK Sbjct: 386 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 415 >ref|NP_200637.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] gi|297793353|ref|XP_002864561.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] gi|565430379|ref|XP_006279634.1| hypothetical protein CARUB_v10026512mg [Capsella rubella] gi|28558168|sp|Q9SEI4.1|PRS6B_ARATH RecName: Full=26S protease regulatory subunit 6B homolog; AltName: Full=26S protease subunit 6B homolog; AltName: Full=26S proteasome AAA-ATPase subunit RPT3; AltName: Full=Protein BMAA insensitive morphology 409; AltName: Full=Regulatory particle triple-A ATPase subunit 3 gi|6652882|gb|AAF22523.1|AF123392_1 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] gi|8777330|dbj|BAA96920.1| 26S proteasome AAA-ATPase subunit RPT3 [Arabidopsis thaliana] gi|17979231|gb|AAL49932.1| AT4g10340/F24G24_140 [Arabidopsis thaliana] gi|56382019|gb|AAV85728.1| At5g58290 [Arabidopsis thaliana] gi|297310396|gb|EFH40820.1| hypothetical protein ARALYDRAFT_495939 [Arabidopsis lyrata subsp. lyrata] gi|332009646|gb|AED97029.1| regulatory particle triple-A ATPase 3 [Arabidopsis thaliana] gi|482548338|gb|EOA12532.1| hypothetical protein CARUB_v10026512mg [Capsella rubella] Length = 408 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 379 KNRYVILPKDFEKGYRANVKKPDTDFEFYK 408 >ref|XP_012486311.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Gossypium raimondii] gi|763769856|gb|KJB37071.1| hypothetical protein B456_006G188400 [Gossypium raimondii] Length = 420 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 391 KNRYVILPKDFEKGYRTNVKKPDTDFEFYK 420 >ref|XP_011040698.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Populus euphratica] Length = 412 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 383 KNRYVILPKDFEKGYRTNVKKPDTDFEFYK 412 >gb|KHN24721.1| 26S protease regulatory subunit 6B like [Glycine soja] Length = 325 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 296 KNRYVILPKDFEKGYRTNVKKPDTDFEFYK 325 >gb|KHN18648.1| 26S protease regulatory subunit 6B like [Glycine soja] Length = 326 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYR+NVKKPDTDFEFYK Sbjct: 297 KNRYVILPKDFEKGYRTNVKKPDTDFEFYK 326 >ref|XP_010684522.1| PREDICTED: 26S protease regulatory subunit 6B homolog [Beta vulgaris subsp. vulgaris] gi|870854188|gb|KMT05993.1| hypothetical protein BVRB_7g164800 [Beta vulgaris subsp. vulgaris] Length = 421 Score = 66.6 bits (161), Expect = 6e-09 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -1 Query: 328 KNRYVILPKDFEKGYRSNVKKPDTDFEFYK 239 KNRYVILPKDFEKGYRSNVKKPDTDF+FYK Sbjct: 392 KNRYVILPKDFEKGYRSNVKKPDTDFDFYK 421