BLASTX nr result
ID: Forsythia23_contig00032333
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00032333 (424 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009605667.1| PREDICTED: uncharacterized protein LOC104100... 54 7e-06 >ref|XP_009605667.1| PREDICTED: uncharacterized protein LOC104100193 [Nicotiana tomentosiformis] Length = 161 Score = 54.3 bits (129), Expect(2) = 7e-06 Identities = 35/99 (35%), Positives = 51/99 (51%), Gaps = 9/99 (9%) Frame = +3 Query: 60 DKIRNENYAPQVNVAPFEDELSG*QLRLFGHVLHRPKEVR*NRLER---------EHRLK 212 DKIRNE+ +V VAP ED++ +LR FGH+ R + R ER R K Sbjct: 67 DKIRNEDIREKVGVAPMEDKMREVRLRWFGHIQRRSTDAPVRRCERLAVVGTRRGRGRPK 126 Query: 213 LLWPDVIAKDIVAFNLQID*AMNRSLAKKIHVSNFKIVG 329 W +VI +D+ + D A++R L + S+ K+VG Sbjct: 127 KYWEEVIRQDMARLRITEDMALDRELWR----SSIKVVG 161 Score = 21.9 bits (45), Expect(2) = 7e-06 Identities = 9/14 (64%), Positives = 11/14 (78%), Gaps = 2/14 (14%) Frame = +1 Query: 37 WMCGHT--ERIR*E 72 WMCGHT ++IR E Sbjct: 59 WMCGHTRMDKIRNE 72