BLASTX nr result
ID: Forsythia23_contig00032324
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00032324 (365 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011078125.1| PREDICTED: protein TIFY 10B-like [Sesamum in... 61 3e-07 gb|AEC12208.1| JAZ1 [Maesa lanceolata] 57 6e-06 emb|CDP03053.1| unnamed protein product [Coffea canephora] 56 8e-06 >ref|XP_011078125.1| PREDICTED: protein TIFY 10B-like [Sesamum indicum] Length = 235 Score = 61.2 bits (147), Expect = 3e-07 Identities = 33/45 (73%), Positives = 35/45 (77%), Gaps = 4/45 (8%) Frame = -1 Query: 365 SLARFLEKRKDRITSKAPYQ----AMAPPKPIKSEEWLGLAPQFP 243 SLARFLEKRKDRIT+ APYQ A APPK +E WLGLAPQFP Sbjct: 187 SLARFLEKRKDRITANAPYQTSKPATAPPK--TAETWLGLAPQFP 229 >gb|AEC12208.1| JAZ1 [Maesa lanceolata] Length = 272 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/45 (57%), Positives = 34/45 (75%), Gaps = 4/45 (8%) Frame = -1 Query: 365 SLARFLEKRKDRITSKAPYQA----MAPPKPIKSEEWLGLAPQFP 243 SL RFLEKRKDR+T++APYQ +PP ++++ WLGLAPQ P Sbjct: 221 SLTRFLEKRKDRVTARAPYQTSYSKASPPIKVENKSWLGLAPQSP 265 >emb|CDP03053.1| unnamed protein product [Coffea canephora] Length = 255 Score = 56.2 bits (134), Expect = 8e-06 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 1/42 (2%) Frame = -1 Query: 365 SLARFLEKRKDRITSKAPYQ-AMAPPKPIKSEEWLGLAPQFP 243 SL +FLEKRKDRIT++APY A KP +S+ WLG APQFP Sbjct: 207 SLTKFLEKRKDRITARAPYPVGAAVSKPAESKTWLGFAPQFP 248