BLASTX nr result
ID: Forsythia23_contig00032300
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00032300 (359 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15274.1| unnamed protein product [Coffea canephora] 95 2e-17 ref|XP_008241393.1| PREDICTED: probable xyloglucan endotransgluc... 95 2e-17 ref|XP_011094597.1| PREDICTED: probable xyloglucan endotransgluc... 94 3e-17 ref|XP_011015586.1| PREDICTED: probable xyloglucan endotransgluc... 92 1e-16 ref|XP_011006618.1| PREDICTED: probable xyloglucan endotransgluc... 92 1e-16 ref|XP_002323501.1| xyloglucan endotransglucosylase/hydrolase pr... 92 1e-16 gb|EYU29883.1| hypothetical protein MIMGU_mgv1a0118911mg, partia... 92 1e-16 ref|XP_007202396.1| hypothetical protein PRUPE_ppa009437mg [Prun... 91 3e-16 ref|XP_010098793.1| putative xyloglucan endotransglucosylase/hyd... 90 7e-16 ref|XP_012082446.1| PREDICTED: probable xyloglucan endotransgluc... 90 7e-16 ref|XP_008442717.1| PREDICTED: probable xyloglucan endotransgluc... 89 9e-16 gb|ACD03222.1| xyloglucan endotransglucosylase/hydrolase 12 [Act... 89 1e-15 ref|XP_006354379.1| PREDICTED: probable xyloglucan endotransgluc... 89 1e-15 ref|XP_004304471.1| PREDICTED: probable xyloglucan endotransgluc... 89 1e-15 ref|XP_004246615.1| PREDICTED: probable xyloglucan endotransgluc... 89 1e-15 emb|CCH26635.1| putative xyloglucan endotransglucosylase/hydrola... 89 2e-15 ref|XP_004137842.1| PREDICTED: probable xyloglucan endotransgluc... 89 2e-15 ref|XP_009133100.1| PREDICTED: probable xyloglucan endotransgluc... 88 2e-15 ref|XP_006294559.1| hypothetical protein CARUB_v10023595mg [Caps... 88 2e-15 gb|KFK36563.1| hypothetical protein AALP_AA4G139600 [Arabis alpina] 88 3e-15 >emb|CDP15274.1| unnamed protein product [Coffea canephora] Length = 259 Score = 95.1 bits (235), Expect = 2e-17 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASPFRSGGL+ QQ RAMQWVQSH+L+YDYC+DYKRDHSLTPECW Sbjct: 213 VSASPFRSGGLSGQQYRAMQWVQSHFLVYDYCRDYKRDHSLTPECW 258 >ref|XP_008241393.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 [Prunus mume] Length = 292 Score = 95.1 bits (235), Expect = 2e-17 Identities = 39/47 (82%), Positives = 44/47 (93%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECWH 219 VSASPF+SGGLT QQ R M+WVQ+H+L+YDYCKDYKRDHSLTPECWH Sbjct: 246 VSASPFQSGGLTQQQYRVMRWVQTHHLVYDYCKDYKRDHSLTPECWH 292 >ref|XP_011094597.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 [Sesamum indicum] Length = 296 Score = 94.4 bits (233), Expect = 3e-17 Identities = 39/46 (84%), Positives = 44/46 (95%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASP+RSG LT QQ+RAMQWVQSHY++YDYC+DYKRDHSLTPECW Sbjct: 250 VSASPYRSGRLTGQQTRAMQWVQSHYMVYDYCRDYKRDHSLTPECW 295 >ref|XP_011015586.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 isoform X1 [Populus euphratica] Length = 294 Score = 92.4 bits (228), Expect = 1e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASPFRSGGLT QQ R+M+WVQ H+++YDYCKDYKRDHSLTPECW Sbjct: 248 VSASPFRSGGLTRQQYRSMRWVQRHHMVYDYCKDYKRDHSLTPECW 293 >ref|XP_011006618.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 isoform X1 [Populus euphratica] Length = 294 Score = 92.4 bits (228), Expect = 1e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASPFRSGGLT QQ R+M+WVQ H+++YDYCKDYKRDHSLTPECW Sbjct: 248 VSASPFRSGGLTRQQYRSMRWVQRHHMVYDYCKDYKRDHSLTPECW 293 >ref|XP_002323501.1| xyloglucan endotransglucosylase/hydrolase protein 32 precursor [Populus trichocarpa] gi|222868131|gb|EEF05262.1| xyloglucan endotransglucosylase/hydrolase protein 32 precursor [Populus trichocarpa] Length = 294 Score = 92.4 bits (228), Expect = 1e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASPFRSGGLT QQ R+M+WVQ H+++YDYCKDYKRDHSLTPECW Sbjct: 248 VSASPFRSGGLTRQQYRSMRWVQRHHMVYDYCKDYKRDHSLTPECW 293 >gb|EYU29883.1| hypothetical protein MIMGU_mgv1a0118911mg, partial [Erythranthe guttata] Length = 77 Score = 92.4 bits (228), Expect = 1e-16 Identities = 40/47 (85%), Positives = 42/47 (89%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECWH 219 VSASP+RS GLT QQS AMQWVQSHYL YDYC+D KRDHSLTPECWH Sbjct: 31 VSASPYRSNGLTGQQSSAMQWVQSHYLAYDYCRDGKRDHSLTPECWH 77 >ref|XP_007202396.1| hypothetical protein PRUPE_ppa009437mg [Prunus persica] gi|462397927|gb|EMJ03595.1| hypothetical protein PRUPE_ppa009437mg [Prunus persica] Length = 292 Score = 90.9 bits (224), Expect = 3e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASPFRSGGLT QQ R M+WVQ+++L+YDYCKDYKRDHSLTPECW Sbjct: 246 VSASPFRSGGLTQQQYRVMRWVQTNHLVYDYCKDYKRDHSLTPECW 291 >ref|XP_010098793.1| putative xyloglucan endotransglucosylase/hydrolase protein 32 [Morus notabilis] gi|587887080|gb|EXB75881.1| putative xyloglucan endotransglucosylase/hydrolase protein 32 [Morus notabilis] Length = 282 Score = 89.7 bits (221), Expect = 7e-16 Identities = 37/46 (80%), Positives = 42/46 (91%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASPFRSGGLT QQ R M+WVQ ++++YDYCKDYKRDHSLTPECW Sbjct: 236 VSASPFRSGGLTRQQYRTMRWVQRYHMVYDYCKDYKRDHSLTPECW 281 >ref|XP_012082446.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 [Jatropha curcas] gi|643717732|gb|KDP29175.1| hypothetical protein JCGZ_16564 [Jatropha curcas] Length = 294 Score = 89.7 bits (221), Expect = 7e-16 Identities = 37/47 (78%), Positives = 43/47 (91%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECWH 219 VSASPFRSGGLT QQ RAM+WVQ+H+++Y+YC D KRDHSLTPECWH Sbjct: 248 VSASPFRSGGLTRQQHRAMRWVQTHHMVYNYCMDPKRDHSLTPECWH 294 >ref|XP_008442717.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 [Cucumis melo] Length = 295 Score = 89.4 bits (220), Expect = 9e-16 Identities = 38/47 (80%), Positives = 42/47 (89%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECWH 219 VSASPFRSGGLT QQ AM+WVQSH+L+Y+YC D KRDHSLTPECWH Sbjct: 249 VSASPFRSGGLTRQQRNAMKWVQSHHLVYNYCWDNKRDHSLTPECWH 295 >gb|ACD03222.1| xyloglucan endotransglucosylase/hydrolase 12 [Actinidia eriantha] Length = 294 Score = 89.0 bits (219), Expect = 1e-15 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASPFRSGGL+T+Q AM+WVQSH+L+YDYC+D KRDHSLTPECW Sbjct: 248 VSASPFRSGGLSTRQYMAMRWVQSHFLVYDYCRDSKRDHSLTPECW 293 >ref|XP_006354379.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32-like [Solanum tuberosum] Length = 298 Score = 89.0 bits (219), Expect = 1e-15 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASP+RSGGL+ QQ +AM WV+SHY++YDYC+D+KRDHSLTPECW Sbjct: 251 VSASPYRSGGLSRQQRQAMNWVRSHYMVYDYCRDFKRDHSLTPECW 296 >ref|XP_004304471.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 [Fragaria vesca subsp. vesca] gi|764617386|ref|XP_011468140.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 [Fragaria vesca subsp. vesca] gi|764617391|ref|XP_011468141.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 [Fragaria vesca subsp. vesca] Length = 293 Score = 89.0 bits (219), Expect = 1e-15 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASPFRSGGLT QQ R M+WVQ+++++YDYC+DYKRDHSLTPECW Sbjct: 247 VSASPFRSGGLTRQQYRVMKWVQANHMVYDYCRDYKRDHSLTPECW 292 >ref|XP_004246615.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 [Solanum lycopersicum] Length = 298 Score = 89.0 bits (219), Expect = 1e-15 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASP+RSGGL+ QQ +AM WV+SHY++YDYC+D+KRDHSLTPECW Sbjct: 251 VSASPYRSGGLSRQQRQAMNWVRSHYMVYDYCRDFKRDHSLTPECW 296 >emb|CCH26635.1| putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus] Length = 292 Score = 88.6 bits (218), Expect = 2e-15 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECWH 219 VSASPFRSGGLT QQ AM+WVQSH L+Y+YC D KRDHSLTPECWH Sbjct: 246 VSASPFRSGGLTRQQKNAMKWVQSHQLVYNYCWDNKRDHSLTPECWH 292 >ref|XP_004137842.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 [Cucumis sativus] gi|700203859|gb|KGN58992.1| hypothetical protein Csa_3G741330 [Cucumis sativus] Length = 292 Score = 88.6 bits (218), Expect = 2e-15 Identities = 38/47 (80%), Positives = 41/47 (87%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECWH 219 VSASPFRSGGLT QQ AM+WVQSH L+Y+YC D KRDHSLTPECWH Sbjct: 246 VSASPFRSGGLTRQQKNAMKWVQSHQLVYNYCWDNKRDHSLTPECWH 292 >ref|XP_009133100.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 32 [Brassica rapa] gi|674878803|emb|CDY53271.1| BnaCnng24730D [Brassica napus] Length = 299 Score = 88.2 bits (217), Expect = 2e-15 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASP+RSGGLT QQ +AM+WVQ+H ++Y+YCKDYKRDHSLTPECW Sbjct: 253 VSASPYRSGGLTRQQYQAMRWVQTHSMVYNYCKDYKRDHSLTPECW 298 >ref|XP_006294559.1| hypothetical protein CARUB_v10023595mg [Capsella rubella] gi|482563267|gb|EOA27457.1| hypothetical protein CARUB_v10023595mg [Capsella rubella] Length = 332 Score = 88.2 bits (217), Expect = 2e-15 Identities = 36/46 (78%), Positives = 43/46 (93%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 VSASP+RSGGLT QQ +AM+WVQ+H ++Y+YCKDYKRDHSLTPECW Sbjct: 286 VSASPYRSGGLTRQQYQAMRWVQTHSMVYNYCKDYKRDHSLTPECW 331 >gb|KFK36563.1| hypothetical protein AALP_AA4G139600 [Arabis alpina] Length = 299 Score = 87.8 bits (216), Expect = 3e-15 Identities = 35/46 (76%), Positives = 43/46 (93%) Frame = -1 Query: 359 VSASPFRSGGLTTQQSRAMQWVQSHYLIYDYCKDYKRDHSLTPECW 222 +SASP+RSGGLT QQ +AM+WVQ+H ++Y+YCKDYKRDHSLTPECW Sbjct: 253 ISASPYRSGGLTRQQYQAMRWVQTHNMVYNYCKDYKRDHSLTPECW 298