BLASTX nr result
ID: Forsythia23_contig00032183
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00032183 (340 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP05912.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_008225094.1| PREDICTED: 3-deoxy-manno-octulosonate cytidy... 57 4e-06 ref|XP_007211713.1| hypothetical protein PRUPE_ppa009339mg [Prun... 57 4e-06 ref|XP_011098319.1| PREDICTED: 3-deoxy-manno-octulosonate cytidy... 57 6e-06 ref|XP_010060550.1| PREDICTED: 3-deoxy-manno-octulosonate cytidy... 57 6e-06 ref|XP_002284913.1| PREDICTED: 3-deoxy-manno-octulosonate cytidy... 56 8e-06 emb|CAN62581.1| hypothetical protein VITISV_036570 [Vitis vinifera] 56 8e-06 >emb|CDP05912.1| unnamed protein product [Coffea canephora] Length = 298 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 338 VIKVDHEAHGVDTPEDVEKIEHYMHKRNLS 249 VIKVDHEAHGVD PEDVEKIEH+M +RNLS Sbjct: 269 VIKVDHEAHGVDAPEDVEKIEHFMRERNLS 298 >ref|XP_008225094.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like [Prunus mume] Length = 296 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 338 VIKVDHEAHGVDTPEDVEKIEHYMHKRNLS 249 VIKVDHEAHGVDTPEDVEKIE +M +RNLS Sbjct: 267 VIKVDHEAHGVDTPEDVEKIESFMRERNLS 296 >ref|XP_007211713.1| hypothetical protein PRUPE_ppa009339mg [Prunus persica] gi|462407578|gb|EMJ12912.1| hypothetical protein PRUPE_ppa009339mg [Prunus persica] Length = 296 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 338 VIKVDHEAHGVDTPEDVEKIEHYMHKRNLS 249 VIKVDHEAHGVDTPEDVEKIE +M +RNLS Sbjct: 267 VIKVDHEAHGVDTPEDVEKIESFMQERNLS 296 >ref|XP_011098319.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial-like [Sesamum indicum] Length = 332 Score = 56.6 bits (135), Expect = 6e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 338 VIKVDHEAHGVDTPEDVEKIEHYMHKRNL 252 VIKVDHE+HGVD PEDV+KIEHYM +RNL Sbjct: 303 VIKVDHESHGVDVPEDVDKIEHYMRQRNL 331 >ref|XP_010060550.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial [Eucalyptus grandis] gi|629101862|gb|KCW67331.1| hypothetical protein EUGRSUZ_F01118 [Eucalyptus grandis] Length = 305 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 338 VIKVDHEAHGVDTPEDVEKIEHYMHKRNLS 249 VIKVDHEAHGVDTPEDV+KIE YM +RNLS Sbjct: 276 VIKVDHEAHGVDTPEDVQKIESYMLERNLS 305 >ref|XP_002284913.1| PREDICTED: 3-deoxy-manno-octulosonate cytidylyltransferase, mitochondrial [Vitis vinifera] gi|302143017|emb|CBI20312.3| unnamed protein product [Vitis vinifera] Length = 297 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 338 VIKVDHEAHGVDTPEDVEKIEHYMHKRNLS 249 VIKVDHEAHGVDTPEDV+KIE +M +RNLS Sbjct: 268 VIKVDHEAHGVDTPEDVDKIESFMRERNLS 297 >emb|CAN62581.1| hypothetical protein VITISV_036570 [Vitis vinifera] Length = 297 Score = 56.2 bits (134), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 338 VIKVDHEAHGVDTPEDVEKIEHYMHKRNLS 249 VIKVDHEAHGVDTPEDV+KIE +M +RNLS Sbjct: 268 VIKVDHEAHGVDTPEDVDKIESFMRERNLS 297