BLASTX nr result
ID: Forsythia23_contig00031224
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00031224 (318 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086274.1| PREDICTED: uncharacterized protein LOC105168... 57 6e-06 >ref|XP_011086274.1| PREDICTED: uncharacterized protein LOC105168054 [Sesamum indicum] Length = 278 Score = 56.6 bits (135), Expect = 6e-06 Identities = 32/57 (56%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = +3 Query: 3 QRSAYPLEQLDLQLNDFARFDEADDIFLRSLLEENGSGIHGAG-SVNFSPTSSNDNL 170 Q++AYP E D QLNDFA DEADDIF SL ++ S I G S NF+ TSS D+L Sbjct: 84 QQNAYPCEHSDFQLNDFAVIDEADDIFFHSLFKD-ASEIDGVDQSANFAQTSSKDDL 139