BLASTX nr result
ID: Forsythia23_contig00031202
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00031202 (423 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006843416.1| PREDICTED: acyl carrier protein 2, mitochond... 76 3e-16 ref|XP_009791272.1| PREDICTED: acyl carrier protein 2, mitochond... 75 3e-16 ref|XP_009598879.1| PREDICTED: acyl carrier protein 2, mitochond... 75 3e-16 ref|XP_010278023.1| PREDICTED: acyl carrier protein 2, mitochond... 77 3e-16 ref|XP_011084672.1| PREDICTED: acyl carrier protein 2, mitochond... 75 6e-16 ref|XP_006480468.1| PREDICTED: acyl carrier protein 2, mitochond... 77 7e-16 gb|ABV08889.1| acyl-carrier-protein [Triadica sebifera] 74 1e-15 ref|XP_010278024.1| PREDICTED: acyl carrier protein 2, mitochond... 76 1e-15 ref|XP_010038639.1| PREDICTED: acyl carrier protein 2, mitochond... 76 1e-15 ref|XP_003624206.1| Acyl carrier protein [Medicago truncatula] g... 74 2e-15 gb|AFK31314.1| acyl carrier protein [Camellia oleifera] 74 3e-15 gb|AFK44710.1| unknown [Lotus japonicus] 74 4e-15 gb|ADB94685.1| acyl carrier protein 2 [Arachis hypogaea] 74 4e-15 gb|ACZ06073.1| acyl carrier protein [Arachis hypogaea] gi|284808... 74 4e-15 ref|XP_002514816.1| acyl carrier protein, putative [Ricinus comm... 75 4e-15 ref|XP_004236631.1| PREDICTED: acyl carrier protein 2, mitochond... 72 4e-15 gb|AFK39233.1| unknown [Lotus japonicus] 74 4e-15 emb|CDP04174.1| unnamed protein product [Coffea canephora] 74 5e-15 emb|CDY37654.1| BnaC04g29960D [Brassica napus] 77 5e-15 ref|NP_001292943.1| acyl carrier protein 2, mitochondrial [Jatro... 75 5e-15 >ref|XP_006843416.1| PREDICTED: acyl carrier protein 2, mitochondrial [Amborella trichopoda] gi|769813275|ref|XP_011622962.1| PREDICTED: acyl carrier protein 2, mitochondrial [Amborella trichopoda] gi|548845783|gb|ERN05091.1| hypothetical protein AMTR_s00053p00140290 [Amborella trichopoda] Length = 128 Score = 75.9 bits (185), Expect(2) = 3e-16 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT +AHFQNDLGL+SLDT+EIVMALEEEFGFEIPDNEA+ Sbjct: 66 VDPSKVTPNAHFQNDLGLDSLDTVEIVMALEEEFGFEIPDNEAD 109 Score = 35.8 bits (81), Expect(2) = 3e-16 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +I+ INLAVNFIASHPQAK Sbjct: 110 KIHTINLAVNFIASHPQAK 128 >ref|XP_009791272.1| PREDICTED: acyl carrier protein 2, mitochondrial-like [Nicotiana sylvestris] Length = 129 Score = 75.5 bits (184), Expect(2) = 3e-16 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT +AHFQNDLGL+SLDT+E+VMALEEEFGFEIPDNEA+ Sbjct: 67 VDPSKVTPNAHFQNDLGLDSLDTVEVVMALEEEFGFEIPDNEAD 110 Score = 35.8 bits (81), Expect(2) = 3e-16 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +IN INLAV+FIASHPQAK Sbjct: 111 KINSINLAVDFIASHPQAK 129 >ref|XP_009598879.1| PREDICTED: acyl carrier protein 2, mitochondrial-like [Nicotiana tomentosiformis] Length = 129 Score = 75.5 bits (184), Expect(2) = 3e-16 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT +AHFQNDLGL+SLDT+E+VMALEEEFGFEIPDNEA+ Sbjct: 67 VDPSKVTPNAHFQNDLGLDSLDTVEVVMALEEEFGFEIPDNEAD 110 Score = 35.8 bits (81), Expect(2) = 3e-16 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +IN INLAV+FIASHPQAK Sbjct: 111 KINSINLAVDFIASHPQAK 129 >ref|XP_010278023.1| PREDICTED: acyl carrier protein 2, mitochondrial isoform X1 [Nelumbo nucifera] Length = 124 Score = 77.4 bits (189), Expect(2) = 3e-16 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVTL AHFQNDLGL+SLDT+E+VMALEEEFGFEIPDNEA+ Sbjct: 62 VDPSKVTLTAHFQNDLGLDSLDTVEVVMALEEEFGFEIPDNEAD 105 Score = 33.9 bits (76), Expect(2) = 3e-16 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +I+ INLAV+FIASHPQAK Sbjct: 106 KISSINLAVDFIASHPQAK 124 >ref|XP_011084672.1| PREDICTED: acyl carrier protein 2, mitochondrial [Sesamum indicum] Length = 126 Score = 74.7 bits (182), Expect(2) = 6e-16 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ KVT +AHFQNDLGL+SLDT+EIVMALEEEFGFEIPDNEA+ Sbjct: 64 VDPAKVTPNAHFQNDLGLDSLDTVEIVMALEEEFGFEIPDNEAD 107 Score = 35.8 bits (81), Expect(2) = 6e-16 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +IN INLAV+FIASHPQAK Sbjct: 108 KINTINLAVDFIASHPQAK 126 >ref|XP_006480468.1| PREDICTED: acyl carrier protein 2, mitochondrial-like [Citrus sinensis] Length = 127 Score = 77.0 bits (188), Expect(2) = 7e-16 Identities = 34/44 (77%), Positives = 43/44 (97%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT++AHFQNDLGL+SLDT+E+VMALEEEFGFEIPDNEA+ Sbjct: 65 VDPSKVTVNAHFQNDLGLDSLDTVEVVMALEEEFGFEIPDNEAD 108 Score = 33.1 bits (74), Expect(2) = 7e-16 Identities = 14/19 (73%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +I+ IN+AV+FIASHPQAK Sbjct: 109 KISTINMAVDFIASHPQAK 127 >gb|ABV08889.1| acyl-carrier-protein [Triadica sebifera] Length = 130 Score = 73.9 bits (180), Expect(2) = 1e-15 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT +AHFQNDLGL SLDT+E+VMALEEEFGFEIPDNEA+ Sbjct: 68 VDPSKVTPNAHFQNDLGLGSLDTVEVVMALEEEFGFEIPDNEAD 111 Score = 35.8 bits (81), Expect(2) = 1e-15 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +IN INLAV+FIASHPQAK Sbjct: 112 KINSINLAVDFIASHPQAK 130 >ref|XP_010278024.1| PREDICTED: acyl carrier protein 2, mitochondrial isoform X2 [Nelumbo nucifera] Length = 119 Score = 75.9 bits (185), Expect(2) = 1e-15 Identities = 35/40 (87%), Positives = 39/40 (97%) Frame = -1 Query: 237 KVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 KVTL AHFQNDLGL+SLDT+E+VMALEEEFGFEIPDNEA+ Sbjct: 61 KVTLTAHFQNDLGLDSLDTVEVVMALEEEFGFEIPDNEAD 100 Score = 33.9 bits (76), Expect(2) = 1e-15 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +I+ INLAV+FIASHPQAK Sbjct: 101 KISSINLAVDFIASHPQAK 119 >ref|XP_010038639.1| PREDICTED: acyl carrier protein 2, mitochondrial [Eucalyptus grandis] gi|629120154|gb|KCW84644.1| hypothetical protein EUGRSUZ_B01464 [Eucalyptus grandis] Length = 129 Score = 75.9 bits (185), Expect(2) = 1e-15 Identities = 35/44 (79%), Positives = 42/44 (95%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT +AHFQNDLGL+SLDT+EIVMALEEEFGFEIPDNEA+ Sbjct: 67 VDPSKVTPNAHFQNDLGLDSLDTVEIVMALEEEFGFEIPDNEAD 110 Score = 33.5 bits (75), Expect(2) = 1e-15 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +IN I LAV+FIASHPQAK Sbjct: 111 KINTIELAVDFIASHPQAK 129 >ref|XP_003624206.1| Acyl carrier protein [Medicago truncatula] gi|217074522|gb|ACJ85621.1| unknown [Medicago truncatula] gi|355499221|gb|AES80424.1| acyl carrier protein [Medicago truncatula] gi|388522041|gb|AFK49082.1| unknown [Medicago truncatula] Length = 130 Score = 73.6 bits (179), Expect(2) = 2e-15 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT AHFQNDLGL+SLD +EIVMALEEEFGFEIPDNEA+ Sbjct: 68 VDPSKVTPSAHFQNDLGLDSLDAVEIVMALEEEFGFEIPDNEAD 111 Score = 35.0 bits (79), Expect(2) = 2e-15 Identities = 14/19 (73%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +IN +NLA++FIASHPQAK Sbjct: 112 KINSVNLAIDFIASHPQAK 130 >gb|AFK31314.1| acyl carrier protein [Camellia oleifera] Length = 129 Score = 74.3 bits (181), Expect(2) = 3e-15 Identities = 34/44 (77%), Positives = 41/44 (93%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT +AHFQNDLGL+SLDT+EIVMA EEEFGFEIPDNEA+ Sbjct: 67 VDPSKVTPNAHFQNDLGLDSLDTVEIVMAFEEEFGFEIPDNEAD 110 Score = 33.9 bits (76), Expect(2) = 3e-15 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +I+ INLAV+FIASHPQAK Sbjct: 111 KISSINLAVDFIASHPQAK 129 >gb|AFK44710.1| unknown [Lotus japonicus] Length = 130 Score = 74.3 bits (181), Expect(2) = 4e-15 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT +AHFQNDLGL+SLD++EIVMALEEEFGFEIPDNEA+ Sbjct: 68 VDPSKVTPNAHFQNDLGLDSLDSVEIVMALEEEFGFEIPDNEAD 111 Score = 33.5 bits (75), Expect(2) = 4e-15 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +IN I LAV+FIASHPQAK Sbjct: 112 KINSIKLAVDFIASHPQAK 130 >gb|ADB94685.1| acyl carrier protein 2 [Arachis hypogaea] Length = 130 Score = 74.3 bits (181), Expect(2) = 4e-15 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT +AHFQNDLGL+SLD++EIVMALEEEFGFEIPDNEA+ Sbjct: 68 VDPSKVTPNAHFQNDLGLDSLDSVEIVMALEEEFGFEIPDNEAD 111 Score = 33.5 bits (75), Expect(2) = 4e-15 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +IN I LAV+FIASHPQAK Sbjct: 112 KINSIQLAVDFIASHPQAK 130 >gb|ACZ06073.1| acyl carrier protein [Arachis hypogaea] gi|284808873|gb|ADB94684.1| acyl carrier protein 2 [Arachis hypogaea] Length = 130 Score = 74.3 bits (181), Expect(2) = 4e-15 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT +AHFQNDLGL+SLD++EIVMALEEEFGFEIPDNEA+ Sbjct: 68 VDPSKVTPNAHFQNDLGLDSLDSVEIVMALEEEFGFEIPDNEAD 111 Score = 33.5 bits (75), Expect(2) = 4e-15 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +IN I LAV+FIASHPQAK Sbjct: 112 KINSIQLAVDFIASHPQAK 130 >ref|XP_002514816.1| acyl carrier protein, putative [Ricinus communis] gi|223545867|gb|EEF47370.1| acyl carrier protein, putative [Ricinus communis] Length = 128 Score = 75.5 bits (184), Expect(2) = 4e-15 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT +AHFQNDLGL+SLDT+E+VMALEEEFGFEIPDNEA+ Sbjct: 66 VDPSKVTPNAHFQNDLGLDSLDTVEVVMALEEEFGFEIPDNEAD 109 Score = 32.3 bits (72), Expect(2) = 4e-15 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +I+ I LAVNFI+SHPQAK Sbjct: 110 KISSIELAVNFISSHPQAK 128 >ref|XP_004236631.1| PREDICTED: acyl carrier protein 2, mitochondrial-like [Solanum lycopersicum] Length = 128 Score = 72.0 bits (175), Expect(2) = 4e-15 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 237 KVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 KV +AHFQNDLGL+SLDT+E+VMALEEEFGFEIPDNEA+ Sbjct: 70 KVVPNAHFQNDLGLDSLDTVEVVMALEEEFGFEIPDNEAD 109 Score = 35.8 bits (81), Expect(2) = 4e-15 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +IN INLAV+FIASHPQAK Sbjct: 110 KINSINLAVDFIASHPQAK 128 >gb|AFK39233.1| unknown [Lotus japonicus] Length = 120 Score = 74.3 bits (181), Expect(2) = 4e-15 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT +AHFQNDLGL+SLD++EIVMALEEEFGFEIPDNEA+ Sbjct: 58 VDPSKVTPNAHFQNDLGLDSLDSVEIVMALEEEFGFEIPDNEAD 101 Score = 33.5 bits (75), Expect(2) = 4e-15 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +IN I LAV+FIASHPQAK Sbjct: 102 KINSIKLAVDFIASHPQAK 120 >emb|CDP04174.1| unnamed protein product [Coffea canephora] Length = 132 Score = 73.6 bits (179), Expect(2) = 5e-15 Identities = 34/44 (77%), Positives = 40/44 (90%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT AHF NDLGL+SLDT+EIVMALEEEFGFEIPDNEA+ Sbjct: 70 VDPSKVTPSAHFHNDLGLDSLDTVEIVMALEEEFGFEIPDNEAD 113 Score = 33.9 bits (76), Expect(2) = 5e-15 Identities = 15/19 (78%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +I+ INLAV+FIASHPQAK Sbjct: 114 KISSINLAVDFIASHPQAK 132 >emb|CDY37654.1| BnaC04g29960D [Brassica napus] Length = 131 Score = 76.6 bits (187), Expect(2) = 5e-15 Identities = 35/44 (79%), Positives = 41/44 (93%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 +E +KVT AHFQNDLGL+SLDT+E+VMALEEEFGFEIPDNEA+ Sbjct: 69 VEPSKVTAKAHFQNDLGLDSLDTVEVVMALEEEFGFEIPDNEAD 112 Score = 30.8 bits (68), Expect(2) = 5e-15 Identities = 13/19 (68%), Positives = 16/19 (84%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +I ++LAV FIASHPQAK Sbjct: 113 KIQSVDLAVEFIASHPQAK 131 >ref|NP_001292943.1| acyl carrier protein 2, mitochondrial [Jatropha curcas] gi|802724623|ref|XP_012085792.1| PREDICTED: acyl carrier protein 2, mitochondrial [Jatropha curcas] gi|145208313|gb|ABP38063.1| acyl carrier protein [Jatropha curcas] gi|257187683|gb|ACV49879.1| acyl carrier protein [Jatropha curcas] gi|643714227|gb|KDP26892.1| hypothetical protein JCGZ_18050 [Jatropha curcas] Length = 130 Score = 75.5 bits (184), Expect(2) = 5e-15 Identities = 34/44 (77%), Positives = 42/44 (95%) Frame = -1 Query: 249 IEVNKVTLDAHFQNDLGLESLDTLEIVMALEEEFGFEIPDNEAE 118 ++ +KVT +AHFQNDLGL+SLDT+E+VMALEEEFGFEIPDNEA+ Sbjct: 68 VDPSKVTPNAHFQNDLGLDSLDTVEVVMALEEEFGFEIPDNEAD 111 Score = 32.0 bits (71), Expect(2) = 5e-15 Identities = 14/19 (73%), Positives = 18/19 (94%) Frame = -2 Query: 119 RINCINLAVNFIASHPQAK 63 +I+ I+LAV+FIASHPQAK Sbjct: 112 KISSISLAVDFIASHPQAK 130