BLASTX nr result
ID: Forsythia23_contig00030957
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00030957 (340 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011090268.1| PREDICTED: protein AIR2 [Sesamum indicum] 73 8e-11 >ref|XP_011090268.1| PREDICTED: protein AIR2 [Sesamum indicum] Length = 480 Score = 72.8 bits (177), Expect = 8e-11 Identities = 35/51 (68%), Positives = 43/51 (84%) Frame = -3 Query: 182 RKVKTPIKEVNTDDDAEANEDLSLKIVQRSMIRACNGDPQKDGVSEIVTNL 30 RK K PI+ +DDDAEANEDLSLKIVQ++M+R C+ DP+ +GVSEIVTNL Sbjct: 21 RKRKNPIEAAISDDDAEANEDLSLKIVQKAMLRTCSIDPRSNGVSEIVTNL 71