BLASTX nr result
ID: Forsythia23_contig00029505
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00029505 (475 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP20466.1| unnamed protein product [Coffea canephora] 66 8e-09 ref|XP_012846375.1| PREDICTED: methionine--tRNA ligase, mitochon... 55 1e-07 ref|XP_003624617.1| hypothetical protein MTR_7g085480 [Medicago ... 55 2e-06 gb|ABN09802.1| hypothetical protein MtrDRAFT_AC167711g44v2 [Medi... 55 2e-06 >emb|CDP20466.1| unnamed protein product [Coffea canephora] Length = 63 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = -3 Query: 245 RAVNHALVRRAHIIHQA*FPVSLELKDTEVRAYRTDP 135 RAVNHALV+R++ IHQ FPVSLELKDTEVRAYRTDP Sbjct: 22 RAVNHALVKRSYFIHQTWFPVSLELKDTEVRAYRTDP 58 >ref|XP_012846375.1| PREDICTED: methionine--tRNA ligase, mitochondrial, partial [Erythranthe guttatus] Length = 817 Score = 55.5 bits (132), Expect(2) = 1e-07 Identities = 25/40 (62%), Positives = 34/40 (85%) Frame = -3 Query: 254 QSHRAVNHALVRRAHIIHQA*FPVSLELKDTEVRAYRTDP 135 +++ ++NHALV + +IHQ+ F VSLE+KDTEVRAYRTDP Sbjct: 205 RANESINHALVEQPWLIHQSWFLVSLEVKDTEVRAYRTDP 244 Score = 26.6 bits (57), Expect(2) = 1e-07 Identities = 12/20 (60%), Positives = 14/20 (70%) Frame = -1 Query: 331 VRQPPDHPSRVNPAENDPLL 272 VRQ DHPS+ +NDPLL Sbjct: 181 VRQLLDHPSQPKLTKNDPLL 200 >ref|XP_003624617.1| hypothetical protein MTR_7g085480 [Medicago truncatula] Length = 81 Score = 54.7 bits (130), Expect(2) = 2e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -3 Query: 257 KQSHRAVNHALVRRAHIIHQA*FPVSLELKDTEVRAYRTDP 135 + HR VNHAL+ R+ I+ Q PVSLE+KDT VR+YRTDP Sbjct: 36 RSHHRTVNHALITRSQILIQIYVPVSLEIKDTVVRSYRTDP 76 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 328 RQPPDHPSRVNPAENDPL 275 R P DHP++ AEND L Sbjct: 10 RLPCDHPNQTGLAENDHL 27 >gb|ABN09802.1| hypothetical protein MtrDRAFT_AC167711g44v2 [Medicago truncatula] Length = 83 Score = 54.7 bits (130), Expect(2) = 2e-06 Identities = 25/41 (60%), Positives = 31/41 (75%) Frame = -3 Query: 257 KQSHRAVNHALVRRAHIIHQA*FPVSLELKDTEVRAYRTDP 135 + HR VNHAL+ R+ I+ Q PVSLE+KDT VR+YRTDP Sbjct: 38 RSHHRTVNHALITRSQILIQIYVPVSLEIKDTVVRSYRTDP 78 Score = 23.9 bits (50), Expect(2) = 2e-06 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -1 Query: 328 RQPPDHPSRVNPAENDPL 275 R P DHP++ AEND L Sbjct: 12 RLPCDHPNQTGLAENDHL 29