BLASTX nr result
ID: Forsythia23_contig00029237
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00029237 (351 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101505.1| PREDICTED: polyadenylation and cleavage fact... 61 3e-07 >ref|XP_011101505.1| PREDICTED: polyadenylation and cleavage factor homolog 4-like, partial [Sesamum indicum] Length = 1042 Score = 60.8 bits (146), Expect = 3e-07 Identities = 41/101 (40%), Positives = 57/101 (56%) Frame = -1 Query: 306 ANDQNQLLHNLAEQDLQLTMNHANSVRSHFLGKLYVGPHNQVSKDSLHMSSWDAYPANSQ 127 +++ NQLL N AE++ Q ++ R G G H Q S+DSL + S D A++Q Sbjct: 579 SHNPNQLL-NFAERN-QTSIGPPTDPRRPS-GHKSTGYHKQSSEDSLPLPSRDVNQASTQ 635 Query: 126 RLHLPSLKTLSPVIPPLQQRHHVPSPHHLKPELSEFESSGE 4 RLH SL++ S IPPLQ + H PS E+ EFES G+ Sbjct: 636 RLHPQSLRSSSAQIPPLQHKKHAPSAQQRNLEVPEFESYGQ 676