BLASTX nr result
ID: Forsythia23_contig00028215
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00028215 (691 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009792096.1| PREDICTED: galactinol synthase 2 [Nicotiana ... 84 6e-14 ref|XP_004494448.1| PREDICTED: galactinol synthase 1-like [Cicer... 84 1e-13 gb|AGW51291.1| putative galactinol synthase [Vicia hirsuta] 82 2e-13 gb|KHN16038.1| Glycogenin-1 [Glycine soja] 82 3e-13 gb|KFK37461.1| hypothetical protein AALP_AA4G260100 [Arabis alpina] 82 3e-13 ref|NP_001238027.1| galactinol synthase [Glycine max] gi|3234569... 82 3e-13 emb|CDP15226.1| unnamed protein product [Coffea canephora] 82 4e-13 gb|KHN02817.1| Glycogenin-1 [Glycine soja] 81 5e-13 gb|AHM22934.1| galactinol synthase 2 [Nicotiana tabacum] 81 5e-13 ref|XP_003555792.1| PREDICTED: galactinol synthase 2 [Glycine max] 81 5e-13 ref|XP_006340652.1| PREDICTED: galactinol synthase 2-like [Solan... 81 6e-13 ref|XP_007145022.1| hypothetical protein PHAVU_007G203400g [Phas... 81 6e-13 gb|ADW78844.1| putative galactinol synthase [Solanum commersonii... 81 6e-13 ref|XP_010094413.1| hypothetical protein L484_018780 [Morus nota... 80 8e-13 ref|XP_010523902.1| PREDICTED: galactinol synthase 1 [Tarenaya h... 80 8e-13 ref|XP_009619498.1| PREDICTED: galactinol synthase 2 [Nicotiana ... 80 8e-13 ref|XP_010544149.1| PREDICTED: galactinol synthase 2-like [Taren... 80 1e-12 emb|CDP15228.1| unnamed protein product [Coffea canephora] 80 1e-12 ref|XP_010069751.1| PREDICTED: galactinol synthase 2-like [Eucal... 80 1e-12 gb|ABF66656.1| galactinol synthase [Ammopiptanthus mongolicus] g... 80 1e-12 >ref|XP_009792096.1| PREDICTED: galactinol synthase 2 [Nicotiana sylvestris] gi|661568599|gb|AIE16185.1| galactinol synthase 2 [Nicotiana tabacum] Length = 333 Score = 84.3 bits (207), Expect = 6e-14 Identities = 44/80 (55%), Positives = 61/80 (76%), Gaps = 4/80 (5%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL++VKV+H+CA G+KPW+YTGEEEN +RE+IKMLV+ + ++LDY K Sbjct: 242 LWRHPENVELEKVKVVHYCAAGSKPWRYTGEEENMDREDIKMLVKKWWDIYNDESLDY-K 300 Query: 196 SLNVPSV---ADKGKAKVKK 246 + NV +V ADK KA + K Sbjct: 301 NANVTAVDAEADKFKAALTK 320 >ref|XP_004494448.1| PREDICTED: galactinol synthase 1-like [Cicer arietinum] Length = 339 Score = 83.6 bits (205), Expect = 1e-13 Identities = 39/79 (49%), Positives = 57/79 (72%), Gaps = 1/79 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHP+++EL++VKV+H+CA G+KPW+YTG+EEN RE+IKMLV+ + +LDY+K Sbjct: 243 LWRHPQNVELRKVKVVHYCAAGSKPWRYTGKEENMQREDIKMLVQKWWDVYNDSSLDYSK 302 Query: 196 SLNVPSVADKGKAKVKKFV 252 SLN S + + + FV Sbjct: 303 SLNGSSETQRNDVENEPFV 321 >gb|AGW51291.1| putative galactinol synthase [Vicia hirsuta] Length = 325 Score = 82.4 bits (202), Expect = 2e-13 Identities = 37/63 (58%), Positives = 50/63 (79%), Gaps = 1/63 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL +VKV+H+CA G+KPW+YTGEEEN RE+IKMLV+ + + +TLDY K Sbjct: 240 LWRHPENVELDKVKVVHYCAAGSKPWRYTGEEENMGREDIKMLVKKWWDVYEDETLDYKK 299 Query: 196 SLN 204 +N Sbjct: 300 PIN 302 >gb|KHN16038.1| Glycogenin-1 [Glycine soja] Length = 328 Score = 82.0 bits (201), Expect = 3e-13 Identities = 37/64 (57%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL +VKV+H+CA G+KPW+YTG+EEN RE+IKMLV+ + + +TLDY Sbjct: 243 LWRHPENVELDKVKVVHYCAAGSKPWRYTGKEENMEREDIKMLVKKWWDIYEDETLDYNN 302 Query: 196 SLNV 207 LNV Sbjct: 303 PLNV 306 >gb|KFK37461.1| hypothetical protein AALP_AA4G260100 [Arabis alpina] Length = 342 Score = 82.0 bits (201), Expect = 3e-13 Identities = 40/80 (50%), Positives = 58/80 (72%), Gaps = 1/80 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL +VKV+H+CA G+KPW+YTG+EEN RE+IKMLV+ + +LDY K Sbjct: 247 LWRHPENVELDKVKVVHYCAAGSKPWRYTGKEENMQREDIKMLVKKWWDIYNDDSLDYKK 306 Query: 196 SLNVPSVADKGKAKVKKFVV 255 S++V + + K+K F+V Sbjct: 307 SVDVVN-TETELVKLKPFIV 325 >ref|NP_001238027.1| galactinol synthase [Glycine max] gi|32345694|gb|AAM96867.1| galactinol synthase [Glycine max] Length = 328 Score = 82.0 bits (201), Expect = 3e-13 Identities = 37/64 (57%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL +VKV+H+CA G+KPW+YTG+EEN RE+IKMLV+ + + +TLDY Sbjct: 243 LWRHPENVELDKVKVVHYCAAGSKPWRYTGKEENMEREDIKMLVKKWWDIYEDETLDYNN 302 Query: 196 SLNV 207 LNV Sbjct: 303 PLNV 306 >emb|CDP15226.1| unnamed protein product [Coffea canephora] Length = 331 Score = 81.6 bits (200), Expect = 4e-13 Identities = 38/76 (50%), Positives = 57/76 (75%), Gaps = 1/76 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL++VKV+H+CA G+KPW+YTG+E+N +RE+IK+LV+N + +TLDY + Sbjct: 240 LWRHPENVELEKVKVVHYCAAGSKPWRYTGKEDNMDREDIKVLVKNWWDIYNDETLDYKR 299 Query: 196 SLNVPSVADKGKAKVK 243 S S G+A+ K Sbjct: 300 SAANISATIGGEAEAK 315 >gb|KHN02817.1| Glycogenin-1 [Glycine soja] Length = 275 Score = 81.3 bits (199), Expect = 5e-13 Identities = 36/64 (56%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL++VKV+H+CA G+KPW+YTG+EEN RE+IKMLV+ + + +TLDY Sbjct: 190 LWRHPENVELEKVKVVHYCAAGSKPWRYTGKEENMEREDIKMLVKKWWDIYEDETLDYNN 249 Query: 196 SLNV 207 NV Sbjct: 250 PFNV 253 >gb|AHM22934.1| galactinol synthase 2 [Nicotiana tabacum] Length = 333 Score = 81.3 bits (199), Expect = 5e-13 Identities = 43/80 (53%), Positives = 60/80 (75%), Gaps = 4/80 (5%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL++VKV+H+CA +KPW+YTGEEEN +RE+IKMLV+ + ++LDY K Sbjct: 242 LWRHPENVELEKVKVVHYCAARSKPWRYTGEEENMDREDIKMLVKKWWDIYNDESLDY-K 300 Query: 196 SLNVPSV---ADKGKAKVKK 246 + NV +V ADK KA + K Sbjct: 301 NANVTAVDAEADKFKAALTK 320 >ref|XP_003555792.1| PREDICTED: galactinol synthase 2 [Glycine max] Length = 324 Score = 81.3 bits (199), Expect = 5e-13 Identities = 36/64 (56%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL++VKV+H+CA G+KPW+YTG+EEN RE+IKMLV+ + + +TLDY Sbjct: 239 LWRHPENVELEKVKVVHYCAAGSKPWRYTGKEENMEREDIKMLVKKWWDIYEDETLDYNN 298 Query: 196 SLNV 207 NV Sbjct: 299 PFNV 302 >ref|XP_006340652.1| PREDICTED: galactinol synthase 2-like [Solanum tuberosum] Length = 337 Score = 80.9 bits (198), Expect = 6e-13 Identities = 38/79 (48%), Positives = 59/79 (74%), Gaps = 1/79 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHLQ*Q-TLDYTK 195 L RHPE+++L++VKV+H+CA G+KPW+YTG+EEN +RE+IKML++ + +LDY K Sbjct: 242 LWRHPENVDLEKVKVVHYCAAGSKPWRYTGKEENMDREDIKMLIKKWWDIYDDVSLDY-K 300 Query: 196 SLNVPSVADKGKAKVKKFV 252 + NV A G+ + +KF+ Sbjct: 301 NSNVVMTAVDGEVEAEKFM 319 >ref|XP_007145022.1| hypothetical protein PHAVU_007G203400g [Phaseolus vulgaris] gi|561018212|gb|ESW17016.1| hypothetical protein PHAVU_007G203400g [Phaseolus vulgaris] Length = 326 Score = 80.9 bits (198), Expect = 6e-13 Identities = 36/68 (52%), Positives = 53/68 (77%), Gaps = 1/68 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL++VKV+H+CA G+KPW+Y+G+EEN RE+IKMLV+ + + ++LDY Sbjct: 241 LWRHPENVELEKVKVVHYCAAGSKPWRYSGKEENMEREDIKMLVKKWWDIYEDKSLDYNN 300 Query: 196 SLNVPSVA 219 SLN +A Sbjct: 301 SLNAQRLA 308 >gb|ADW78844.1| putative galactinol synthase [Solanum commersonii] gi|321268085|gb|ADW78845.1| putative galactinol synthase [Solanum commersonii] Length = 327 Score = 80.9 bits (198), Expect = 6e-13 Identities = 34/63 (53%), Positives = 51/63 (80%), Gaps = 1/63 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++E+ +VKV+H+CA G+KPW+YTGEEEN +R++IKMLV+N + ++LDY Sbjct: 241 LWRHPENVEIDKVKVVHYCAAGSKPWRYTGEEENMDRQDIKMLVKNWTEIYNDESLDYNN 300 Query: 196 SLN 204 ++N Sbjct: 301 NIN 303 >ref|XP_010094413.1| hypothetical protein L484_018780 [Morus notabilis] gi|587866537|gb|EXB55994.1| hypothetical protein L484_018780 [Morus notabilis] Length = 340 Score = 80.5 bits (197), Expect = 8e-13 Identities = 36/64 (56%), Positives = 51/64 (79%), Gaps = 1/64 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL++VKV+H+CA G+KPW+YTG+EEN RE+IKMLV+ + ++LDY K Sbjct: 243 LWRHPENVELEKVKVVHYCAAGSKPWRYTGKEENMEREDIKMLVKKWWDIYNDESLDYKK 302 Query: 196 SLNV 207 S+ V Sbjct: 303 SVGV 306 >ref|XP_010523902.1| PREDICTED: galactinol synthase 1 [Tarenaya hassleriana] Length = 336 Score = 80.5 bits (197), Expect = 8e-13 Identities = 40/77 (51%), Positives = 56/77 (72%), Gaps = 1/77 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL +VKV+H+CA G+KPW+YTGEEEN +RE+IKMLV+ + ++LDY K Sbjct: 240 LWRHPENVELDKVKVVHYCAAGSKPWRYTGEEENMDREDIKMLVKKWWDIYNDESLDYKK 299 Query: 196 SLNVPSVADKGKAKVKK 246 S +VA G+ + K Sbjct: 300 S---SAVAGNGETEPVK 313 >ref|XP_009619498.1| PREDICTED: galactinol synthase 2 [Nicotiana tomentosiformis] Length = 334 Score = 80.5 bits (197), Expect = 8e-13 Identities = 42/80 (52%), Positives = 60/80 (75%), Gaps = 4/80 (5%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE+++L +VKV+H+CA G+KPW+YTGEEEN +RE+IKMLV+ + ++L+Y K Sbjct: 243 LWRHPENVDLDKVKVVHYCAAGSKPWRYTGEEENMDREDIKMLVKKWWDIYNDESLNY-K 301 Query: 196 SLNVPSV---ADKGKAKVKK 246 + NV +V ADK KA + K Sbjct: 302 NANVTAVDAEADKFKAALTK 321 >ref|XP_010544149.1| PREDICTED: galactinol synthase 2-like [Tarenaya hassleriana] Length = 330 Score = 80.1 bits (196), Expect = 1e-12 Identities = 37/63 (58%), Positives = 49/63 (77%), Gaps = 1/63 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE+IEL +VKV+H+CA G+KPW+YTGEEEN RE+IKMLV+ + ++LDY K Sbjct: 231 LWRHPENIELDKVKVVHYCAAGSKPWRYTGEEENMEREDIKMLVKKWRDIYNDESLDYDK 290 Query: 196 SLN 204 + N Sbjct: 291 NKN 293 >emb|CDP15228.1| unnamed protein product [Coffea canephora] Length = 335 Score = 80.1 bits (196), Expect = 1e-12 Identities = 35/62 (56%), Positives = 51/62 (82%), Gaps = 1/62 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL++VKV+H+CA G+KPW+YTG+E+N +RE+IKMLV+ + +TLDY + Sbjct: 241 LWRHPENVELEKVKVVHYCAAGSKPWRYTGQEQNMHREDIKMLVKKWWDIYDDETLDYKR 300 Query: 196 SL 201 SL Sbjct: 301 SL 302 >ref|XP_010069751.1| PREDICTED: galactinol synthase 2-like [Eucalyptus grandis] gi|629092196|gb|KCW58191.1| hypothetical protein EUGRSUZ_H00906 [Eucalyptus grandis] Length = 337 Score = 80.1 bits (196), Expect = 1e-12 Identities = 38/74 (51%), Positives = 57/74 (77%), Gaps = 1/74 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL++VKV+H+CA G+KPW+YTG+EEN RE+IKMLV+ + + ++LDY K Sbjct: 239 LWRHPENVELEKVKVVHYCAAGSKPWRYTGKEENMQREDIKMLVKKWWDIYEDESLDYKK 298 Query: 196 SLNVPSVADKGKAK 237 V + A +G+A+ Sbjct: 299 KAAVAAAA-QGEAE 311 >gb|ABF66656.1| galactinol synthase [Ammopiptanthus mongolicus] gi|155966100|gb|ABU41005.1| galactinol synthase [Ammopiptanthus mongolicus] Length = 328 Score = 80.1 bits (196), Expect = 1e-12 Identities = 36/64 (56%), Positives = 50/64 (78%), Gaps = 1/64 (1%) Frame = +1 Query: 19 LRRHPEDIELKRVKVIHFCAKGTKPWKYTGEEENTNREEIKMLVRNGGHL-Q*QTLDYTK 195 L RHPE++EL +V+V+H+CA G+KPW+YTG+EEN RE+IKMLV+ + + +TLDY Sbjct: 243 LWRHPENVELDKVQVVHYCAAGSKPWRYTGKEENMEREDIKMLVKKWWDIYEDETLDYDN 302 Query: 196 SLNV 207 LNV Sbjct: 303 PLNV 306