BLASTX nr result
ID: Forsythia23_contig00027156
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00027156 (401 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087365.1| PREDICTED: presenilins-associated rhomboid-l... 56 8e-06 >ref|XP_011087365.1| PREDICTED: presenilins-associated rhomboid-like protein, mitochondrial [Sesamum indicum] Length = 333 Score = 56.2 bits (134), Expect = 8e-06 Identities = 29/52 (55%), Positives = 33/52 (63%) Frame = -3 Query: 159 MQRQFCIKLLSKISKNVSNPNTNLISSQPLLSSFLKTNTNPYSHQLCNQSFS 4 MQRQ CIKLLSKI +N S NTN I SSFLK+N NP+ Q +Q S Sbjct: 1 MQRQLCIKLLSKIPRNASTTNTNSIFQPSYSSSFLKSNANPFYQQSISQHSS 52