BLASTX nr result
ID: Forsythia23_contig00027088
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00027088 (379 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO97433.1| unnamed protein product [Coffea canephora] 103 3e-20 ref|XP_011097881.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 102 8e-20 ref|XP_011097809.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 102 8e-20 gb|EPS66965.1| hypothetical protein M569_07807 [Genlisea aurea] 102 8e-20 ref|XP_011074871.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 99 1e-18 ref|XP_010267451.1| PREDICTED: dnaJ homolog 1, mitochondrial [Ne... 98 2e-18 ref|XP_012854931.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 97 3e-18 ref|XP_009783902.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 95 2e-17 ref|XP_009604522.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 95 2e-17 ref|XP_010928256.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 94 3e-17 ref|XP_002274349.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 93 6e-17 emb|CAN71908.1| hypothetical protein VITISV_038674 [Vitis vinifera] 93 6e-17 ref|XP_002534212.1| chaperone protein DNAj, putative [Ricinus co... 92 1e-16 ref|XP_011022808.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 92 1e-16 ref|XP_010686405.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 92 1e-16 ref|XP_008788886.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 92 1e-16 ref|XP_002310554.1| hypothetical protein POPTR_0007s05240g [Popu... 92 1e-16 ref|XP_010038071.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 91 2e-16 ref|XP_007159670.1| hypothetical protein PHAVU_002G2573000g [Pha... 91 2e-16 ref|XP_012853436.1| PREDICTED: dnaJ homolog 1, mitochondrial-lik... 91 3e-16 >emb|CDO97433.1| unnamed protein product [Coffea canephora] Length = 439 Score = 103 bits (258), Expect = 3e-20 Identities = 51/55 (92%), Positives = 54/55 (98%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVPFLNKSNMRGDQLV+VQVEIPKRLS EERKLIEELANLNK+KAPNSRR Sbjct: 385 VMAKKGVPFLNKSNMRGDQLVRVQVEIPKRLSGEERKLIEELANLNKAKAPNSRR 439 >ref|XP_011097881.1| PREDICTED: dnaJ homolog 1, mitochondrial-like, partial [Sesamum indicum] Length = 333 Score = 102 bits (255), Expect = 8e-20 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP LNKSNMRGDQLVKVQVEIPKRLS EERKLIEELANLNK+KAPNSRR Sbjct: 279 VMAKKGVPLLNKSNMRGDQLVKVQVEIPKRLSGEERKLIEELANLNKAKAPNSRR 333 >ref|XP_011097809.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Sesamum indicum] Length = 445 Score = 102 bits (255), Expect = 8e-20 Identities = 51/55 (92%), Positives = 53/55 (96%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP LNKSNMRGDQLVKVQVEIPKRLS EERKLIEELANLNK+KAPNSRR Sbjct: 391 VMAKKGVPLLNKSNMRGDQLVKVQVEIPKRLSGEERKLIEELANLNKAKAPNSRR 445 >gb|EPS66965.1| hypothetical protein M569_07807 [Genlisea aurea] Length = 421 Score = 102 bits (255), Expect = 8e-20 Identities = 50/55 (90%), Positives = 54/55 (98%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVPFLNKSNMRGDQLVKVQVEIPKRL +EE+KLIEELANLNK+KAPNSRR Sbjct: 367 VMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLGSEEKKLIEELANLNKAKAPNSRR 421 >ref|XP_011074871.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Sesamum indicum] Length = 440 Score = 99.0 bits (245), Expect = 1e-18 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVPFLNKSNMRGDQLVKVQVEIPKR+S EERKLIEELANLNK+KA +SRR Sbjct: 386 VMAKKGVPFLNKSNMRGDQLVKVQVEIPKRVSGEERKLIEELANLNKAKASSSRR 440 >ref|XP_010267451.1| PREDICTED: dnaJ homolog 1, mitochondrial [Nelumbo nucifera] Length = 442 Score = 98.2 bits (243), Expect = 2e-18 Identities = 48/55 (87%), Positives = 52/55 (94%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVPFLNKSNMRGDQLV+VQVEIPKRLS EERKLIEELANLNK++ NSRR Sbjct: 388 VMAKKGVPFLNKSNMRGDQLVRVQVEIPKRLSGEERKLIEELANLNKARTANSRR 442 >ref|XP_012854931.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Erythranthe guttatus] gi|848913824|ref|XP_012854932.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Erythranthe guttatus] gi|604303457|gb|EYU22930.1| hypothetical protein MIMGU_mgv1a006421mg [Erythranthe guttata] Length = 444 Score = 97.4 bits (241), Expect = 3e-18 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP LNK+NMRGDQLVKVQVEIPKRLS EE+KLIEELA+LNK+KAPNS+R Sbjct: 390 VMAKKGVPLLNKNNMRGDQLVKVQVEIPKRLSGEEKKLIEELADLNKAKAPNSKR 444 >ref|XP_009783902.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Nicotiana sylvestris] gi|698424515|ref|XP_009783909.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Nicotiana sylvestris] Length = 444 Score = 94.7 bits (234), Expect = 2e-17 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP+L+K NMRGDQLV+VQVEIPKRLS+EERKLIEELANLNK+K PNS R Sbjct: 390 VMAKKGVPYLSKPNMRGDQLVRVQVEIPKRLSSEERKLIEELANLNKAKTPNSVR 444 >ref|XP_009604522.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Nicotiana tomentosiformis] gi|697190911|ref|XP_009604523.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Nicotiana tomentosiformis] Length = 444 Score = 94.7 bits (234), Expect = 2e-17 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP+L+K NMRGDQLV+VQVEIPKRLS+EERKLIEELANLNK+K PNS R Sbjct: 390 VMAKKGVPYLSKPNMRGDQLVRVQVEIPKRLSSEERKLIEELANLNKAKTPNSVR 444 >ref|XP_010928256.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Elaeis guineensis] gi|743808102|ref|XP_010928257.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Elaeis guineensis] Length = 451 Score = 94.0 bits (232), Expect = 3e-17 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP+L KSN RGDQLV+VQVEIPKRLS+EERKLIEELANLNK+K NSRR Sbjct: 397 VMAKKGVPYLGKSNTRGDQLVRVQVEIPKRLSSEERKLIEELANLNKTKTANSRR 451 >ref|XP_002274349.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Vitis vinifera] Length = 447 Score = 93.2 bits (230), Expect = 6e-17 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP LNKSNMRGDQLV+VQVEIPKRLS+EE+KLIEELANL+K KA SRR Sbjct: 393 VMAKKGVPLLNKSNMRGDQLVRVQVEIPKRLSSEEKKLIEELANLSKGKAATSRR 447 >emb|CAN71908.1| hypothetical protein VITISV_038674 [Vitis vinifera] Length = 603 Score = 93.2 bits (230), Expect = 6e-17 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP LNKSNMRGDQLV+VQVEIPKRLS+EE+KLIEELANL+K KA SRR Sbjct: 549 VMAKKGVPLLNKSNMRGDQLVRVQVEIPKRLSSEEKKLIEELANLSKGKAATSRR 603 >ref|XP_002534212.1| chaperone protein DNAj, putative [Ricinus communis] gi|223525697|gb|EEF28168.1| chaperone protein DNAj, putative [Ricinus communis] Length = 446 Score = 92.4 bits (228), Expect = 1e-16 Identities = 46/55 (83%), Positives = 52/55 (94%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP LNKSNMRGDQLV+VQVEIPKRLS+EERKLIEELA+L+KSK +SRR Sbjct: 392 VMAKKGVPVLNKSNMRGDQLVRVQVEIPKRLSSEERKLIEELADLSKSKTASSRR 446 >ref|XP_011022808.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Populus euphratica] gi|743826489|ref|XP_011022809.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Populus euphratica] gi|743826492|ref|XP_011022810.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Populus euphratica] Length = 438 Score = 92.0 bits (227), Expect = 1e-16 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP LNKSNMRGDQLV+VQVEIPKRLS+EERKLIEELA+L+K KA SRR Sbjct: 384 VMAKKGVPVLNKSNMRGDQLVRVQVEIPKRLSSEERKLIEELADLSKGKAATSRR 438 >ref|XP_010686405.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Beta vulgaris subsp. vulgaris] gi|870852688|gb|KMT04603.1| hypothetical protein BVRB_8g182590 [Beta vulgaris subsp. vulgaris] Length = 442 Score = 92.0 bits (227), Expect = 1e-16 Identities = 43/53 (81%), Positives = 51/53 (96%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNS 219 +MAKKGVP LNK N+RGDQLV+VQVEIPKRLS++ERKL+EEL+NLNK+KAPNS Sbjct: 386 VMAKKGVPLLNKPNIRGDQLVRVQVEIPKRLSDDERKLVEELSNLNKAKAPNS 438 >ref|XP_008788886.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Phoenix dactylifera] Length = 474 Score = 92.0 bits (227), Expect = 1e-16 Identities = 45/55 (81%), Positives = 50/55 (90%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP+L K N RGDQLV+VQVEIPKRLS+EERKLIEELANLNK+K NSRR Sbjct: 420 VMAKKGVPYLGKPNTRGDQLVRVQVEIPKRLSSEERKLIEELANLNKAKTANSRR 474 >ref|XP_002310554.1| hypothetical protein POPTR_0007s05240g [Populus trichocarpa] gi|222853457|gb|EEE91004.1| hypothetical protein POPTR_0007s05240g [Populus trichocarpa] Length = 441 Score = 92.0 bits (227), Expect = 1e-16 Identities = 46/55 (83%), Positives = 51/55 (92%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP LNKSNMRGDQLV+VQVEIPKRLS+EERKLIEELA+L+K KA SRR Sbjct: 387 VMAKKGVPVLNKSNMRGDQLVRVQVEIPKRLSSEERKLIEELADLSKGKAATSRR 441 >ref|XP_010038071.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Eucalyptus grandis] gi|629083427|gb|KCW49872.1| hypothetical protein EUGRSUZ_K03340 [Eucalyptus grandis] gi|629083428|gb|KCW49873.1| hypothetical protein EUGRSUZ_K03340 [Eucalyptus grandis] Length = 442 Score = 91.3 bits (225), Expect = 2e-16 Identities = 44/55 (80%), Positives = 52/55 (94%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVP+LNKSNMRGDQLV+VQVEIPKRLS+EERKL+E+LA+L+K KA SRR Sbjct: 388 VMAKKGVPYLNKSNMRGDQLVRVQVEIPKRLSSEERKLVEQLADLSKGKATASRR 442 >ref|XP_007159670.1| hypothetical protein PHAVU_002G2573000g [Phaseolus vulgaris] gi|593793264|ref|XP_007159671.1| hypothetical protein PHAVU_002G2573000g [Phaseolus vulgaris] gi|561033085|gb|ESW31664.1| hypothetical protein PHAVU_002G2573000g [Phaseolus vulgaris] gi|561033086|gb|ESW31665.1| hypothetical protein PHAVU_002G2573000g [Phaseolus vulgaris] Length = 438 Score = 91.3 bits (225), Expect = 2e-16 Identities = 44/55 (80%), Positives = 50/55 (90%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVPFLNK+NMRGDQLV+VQVEIPKRLSN+ERKLIEELA+L+K K RR Sbjct: 384 VMAKKGVPFLNKNNMRGDQLVRVQVEIPKRLSNDERKLIEELADLSKGKTATGRR 438 >ref|XP_012853436.1| PREDICTED: dnaJ homolog 1, mitochondrial-like [Erythranthe guttatus] Length = 437 Score = 90.9 bits (224), Expect = 3e-16 Identities = 46/55 (83%), Positives = 50/55 (90%) Frame = -3 Query: 377 IMAKKGVPFLNKSNMRGDQLVKVQVEIPKRLSNEERKLIEELANLNKSKAPNSRR 213 +MAKKGVPFLNKSN RGDQLVKVQVEIPKRLS EE+KLIEEL+ LNK+KA SRR Sbjct: 383 VMAKKGVPFLNKSNRRGDQLVKVQVEIPKRLSVEEKKLIEELSELNKAKATASRR 437