BLASTX nr result
ID: Forsythia23_contig00026921
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00026921 (462 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP17423.1| unnamed protein product [Coffea canephora] 59 1e-06 >emb|CDP17423.1| unnamed protein product [Coffea canephora] Length = 357 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/37 (70%), Positives = 31/37 (83%) Frame = +3 Query: 9 LCHVYKLLMNSLYGRFGINPVRTIIEVCDWERYDYLI 119 L +VYK+LMNSLYGRFGINP TI EVCD +RY +L+ Sbjct: 116 LAYVYKILMNSLYGRFGINPKSTITEVCDVDRYKHLV 152