BLASTX nr result
ID: Forsythia23_contig00026655
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00026655 (427 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843116.1| PREDICTED: mucin-7 [Erythranthe guttatus] 59 1e-06 emb|CDO99330.1| unnamed protein product [Coffea canephora] 59 2e-06 ref|XP_006362566.1| PREDICTED: uncharacterized protein LOC102594... 59 2e-06 >ref|XP_012843116.1| PREDICTED: mucin-7 [Erythranthe guttatus] Length = 308 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = -3 Query: 203 EEPVEEAVWVEKKGDYLVLHFRGPCGKGYQILLCG 99 E P +EAVWVEK GD LVLHF+ PCG GYQILL G Sbjct: 264 ENPKQEAVWVEKNGDCLVLHFKCPCGNGYQILLSG 298 >emb|CDO99330.1| unnamed protein product [Coffea canephora] Length = 327 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = -3 Query: 197 PVEEAVWVEKKGDYLVLHFRGPCGKGYQILLCGYS 93 P EEAVWVE+ G+ L+LHF+ PCGKGYQILL G S Sbjct: 285 PCEEAVWVERNGECLILHFKCPCGKGYQILLTGKS 319 >ref|XP_006362566.1| PREDICTED: uncharacterized protein LOC102594069 [Solanum tuberosum] Length = 333 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 191 EEAVWVEKKGDYLVLHFRGPCGKGYQILLCG 99 EEAVWVE+ G+ L+LHF+ PCGKGYQILLCG Sbjct: 293 EEAVWVERMGNCLILHFKCPCGKGYQILLCG 323