BLASTX nr result
ID: Forsythia23_contig00026625
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00026625 (374 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096550.1| PREDICTED: prefoldin subunit 6 [Sesamum indi... 58 2e-06 ref|XP_012842220.1| PREDICTED: prefoldin subunit 6 [Erythranthe ... 58 2e-06 ref|XP_006449684.1| hypothetical protein CICLE_v10017164mg [Citr... 58 2e-06 gb|AFK40751.1| unknown [Lotus japonicus] 58 2e-06 ref|XP_011460190.1| PREDICTED: LOW QUALITY PROTEIN: prefoldin su... 57 4e-06 >ref|XP_011096550.1| PREDICTED: prefoldin subunit 6 [Sesamum indicum] Length = 127 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -3 Query: 372 DLEEKQNSKKEAIFKVQQRIQSLQAGKGKA 283 DLEEKQNSKKEAIFK+QQRIQ+LQAGKGKA Sbjct: 98 DLEEKQNSKKEAIFKLQQRIQALQAGKGKA 127 >ref|XP_012842220.1| PREDICTED: prefoldin subunit 6 [Erythranthe guttatus] gi|604327600|gb|EYU33357.1| hypothetical protein MIMGU_mgv1a016300mg [Erythranthe guttata] Length = 127 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 372 DLEEKQNSKKEAIFKVQQRIQSLQAGKGKA 283 DLEEKQNSKKEAIFKVQQRIQSLQAGK KA Sbjct: 98 DLEEKQNSKKEAIFKVQQRIQSLQAGKAKA 127 >ref|XP_006449684.1| hypothetical protein CICLE_v10017164mg [Citrus clementina] gi|568826230|ref|XP_006467476.1| PREDICTED: prefoldin subunit 6-like [Citrus sinensis] gi|557552295|gb|ESR62924.1| hypothetical protein CICLE_v10017164mg [Citrus clementina] gi|641859473|gb|KDO78163.1| hypothetical protein CISIN_1g032938mg [Citrus sinensis] Length = 130 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 372 DLEEKQNSKKEAIFKVQQRIQSLQAGKGKA 283 DLEEKQNSKKEAIFKVQQRIQSLQAGK KA Sbjct: 101 DLEEKQNSKKEAIFKVQQRIQSLQAGKAKA 130 >gb|AFK40751.1| unknown [Lotus japonicus] Length = 129 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/30 (96%), Positives = 29/30 (96%) Frame = -3 Query: 372 DLEEKQNSKKEAIFKVQQRIQSLQAGKGKA 283 DLEEKQNSKKEAI KVQQRIQSLQAGKGKA Sbjct: 100 DLEEKQNSKKEAIMKVQQRIQSLQAGKGKA 129 >ref|XP_011460190.1| PREDICTED: LOW QUALITY PROTEIN: prefoldin subunit 6 [Fragaria vesca subsp. vesca] Length = 132 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -3 Query: 372 DLEEKQNSKKEAIFKVQQRIQSLQAGKGKA 283 D+EEKQNSKKEAIFKVQQRIQSLQAGK KA Sbjct: 103 DMEEKQNSKKEAIFKVQQRIQSLQAGKAKA 132