BLASTX nr result
ID: Forsythia23_contig00026533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00026533 (438 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012852473.1| PREDICTED: carboxymethylenebutenolidase homo... 59 1e-06 ref|XP_011100307.1| PREDICTED: carboxymethylenebutenolidase homo... 59 2e-06 ref|XP_004144499.1| PREDICTED: carboxymethylenebutenolidase homo... 56 8e-06 >ref|XP_012852473.1| PREDICTED: carboxymethylenebutenolidase homolog [Erythranthe guttatus] gi|604305696|gb|EYU24784.1| hypothetical protein MIMGU_mgv1a011215mg [Erythranthe guttata] Length = 289 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = -2 Query: 437 QRRKNMGLTDEDDVAVELAWTRFRNWMSRFLSI 339 +RRKNMG+ DED AVELAWTRFR+WM+RFLS+ Sbjct: 257 ERRKNMGMNDEDADAVELAWTRFRSWMTRFLSV 289 >ref|XP_011100307.1| PREDICTED: carboxymethylenebutenolidase homolog [Sesamum indicum] Length = 290 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = -2 Query: 437 QRRKNMGLTDEDDVAVELAWTRFRNWMSRFLS 342 QRRKNMG+ DED VELAWTRFR+WM+RFLS Sbjct: 258 QRRKNMGMNDEDAATVELAWTRFRSWMTRFLS 289 >ref|XP_004144499.1| PREDICTED: carboxymethylenebutenolidase homolog [Cucumis sativus] gi|700188275|gb|KGN43508.1| hypothetical protein Csa_7G043010 [Cucumis sativus] Length = 280 Score = 56.2 bits (134), Expect = 8e-06 Identities = 23/32 (71%), Positives = 30/32 (93%) Frame = -2 Query: 437 QRRKNMGLTDEDDVAVELAWTRFRNWMSRFLS 342 +RRKNMG+ DEDD AVELAW+RF++WMS++LS Sbjct: 248 KRRKNMGMNDEDDNAVELAWSRFQSWMSKYLS 279