BLASTX nr result
ID: Forsythia23_contig00026445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00026445 (507 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097116.1| PREDICTED: acidic leucine-rich nuclear phosp... 60 6e-07 >ref|XP_011097116.1| PREDICTED: acidic leucine-rich nuclear phosphoprotein 32-related protein [Sesamum indicum] Length = 459 Score = 60.1 bits (144), Expect = 6e-07 Identities = 34/56 (60%), Positives = 37/56 (66%), Gaps = 14/56 (25%) Frame = -3 Query: 127 YLIQPVGQVHVDA-----------EMEEDINDEDDQDGEVQEIPTPS---RKRNRD 2 YL+QPVG+V VDA EMEEDI DEDDQDGEVQE+P S RKRN D Sbjct: 380 YLVQPVGRVEVDAGGSDMGEGEDPEMEEDIEDEDDQDGEVQELPPSSSHKRKRNDD 435