BLASTX nr result
ID: Forsythia23_contig00026338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00026338 (428 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009768197.1| PREDICTED: B3 domain-containing transcriptio... 75 2e-11 ref|XP_009768196.1| PREDICTED: B3 domain-containing transcriptio... 75 2e-11 ref|XP_009589565.1| PREDICTED: B3 domain-containing transcriptio... 75 2e-11 ref|XP_009589564.1| PREDICTED: B3 domain-containing transcriptio... 75 2e-11 ref|XP_006362352.1| PREDICTED: B3 domain-containing protein Os07... 74 3e-11 ref|XP_006362351.1| PREDICTED: B3 domain-containing protein Os07... 74 3e-11 ref|XP_004249040.1| PREDICTED: B3 domain-containing transcriptio... 72 1e-10 ref|XP_011095138.1| PREDICTED: B3 domain-containing transcriptio... 70 7e-10 gb|KDO64091.1| hypothetical protein CISIN_1g002708mg [Citrus sin... 70 7e-10 gb|KDO64089.1| hypothetical protein CISIN_1g002708mg [Citrus sin... 70 7e-10 ref|XP_006481192.1| PREDICTED: B3 domain-containing transcriptio... 70 7e-10 ref|XP_006429577.1| hypothetical protein CICLE_v10011039mg [Citr... 70 7e-10 ref|XP_007033532.1| Transcription factor, putative isoform 3 [Th... 69 9e-10 ref|XP_007033531.1| High-level expression of sugar-inducible gen... 69 9e-10 ref|XP_007033530.1| High-level expression of sugar-inducible gen... 69 9e-10 ref|XP_012454319.1| PREDICTED: B3 domain-containing transcriptio... 68 2e-09 ref|XP_012454315.1| PREDICTED: B3 domain-containing transcriptio... 68 2e-09 gb|KHG24632.1| B3 domain-containing transcription repressor VAL2... 68 2e-09 gb|KJB20513.1| hypothetical protein B456_003G152700 [Gossypium r... 67 5e-09 ref|XP_011466419.1| PREDICTED: B3 domain-containing transcriptio... 67 6e-09 >ref|XP_009768197.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X2 [Nicotiana sylvestris] Length = 827 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 MDS+ CMNGVCGA+S SIEWKKGWPL+SG FA LC KCGTAY Sbjct: 1 MDSKICMNGVCGATS----SIEWKKGWPLKSGEFACLCDKCGTAY 41 >ref|XP_009768196.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X1 [Nicotiana sylvestris] Length = 910 Score = 75.1 bits (183), Expect = 2e-11 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 MDS+ CMNGVCGA+S SIEWKKGWPL+SG FA LC KCGTAY Sbjct: 1 MDSKICMNGVCGATS----SIEWKKGWPLKSGEFACLCDKCGTAY 41 >ref|XP_009589565.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X2 [Nicotiana tomentosiformis] Length = 827 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 MDS+ CMNGVCGA+S SIEWKKGWPL+SG FA LC KCGTAY Sbjct: 1 MDSKICMNGVCGATS----SIEWKKGWPLKSGEFAYLCDKCGTAY 41 >ref|XP_009589564.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X1 [Nicotiana tomentosiformis] Length = 909 Score = 74.7 bits (182), Expect = 2e-11 Identities = 34/45 (75%), Positives = 37/45 (82%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 MDS+ CMNGVCGA+S SIEWKKGWPL+SG FA LC KCGTAY Sbjct: 1 MDSKICMNGVCGATS----SIEWKKGWPLKSGEFAYLCDKCGTAY 41 >ref|XP_006362352.1| PREDICTED: B3 domain-containing protein Os07g0679700-like isoform X2 [Solanum tuberosum] Length = 827 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M+S+ CMNG+CGA+S IEWKKGWPLRSG FATLC KCGTAY Sbjct: 1 MESKICMNGLCGATSL----IEWKKGWPLRSGEFATLCDKCGTAY 41 >ref|XP_006362351.1| PREDICTED: B3 domain-containing protein Os07g0679700-like isoform X1 [Solanum tuberosum] Length = 908 Score = 74.3 bits (181), Expect = 3e-11 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M+S+ CMNG+CGA+S IEWKKGWPLRSG FATLC KCGTAY Sbjct: 1 MESKICMNGLCGATSL----IEWKKGWPLRSGEFATLCDKCGTAY 41 >ref|XP_004249040.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X2 [Solanum lycopersicum] Length = 908 Score = 72.4 bits (176), Expect = 1e-10 Identities = 32/45 (71%), Positives = 36/45 (80%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M+S+ CMNG+CG +S SIEWKKGWPLRSG FATLC KCG AY Sbjct: 1 MESKICMNGLCGTTS----SIEWKKGWPLRSGEFATLCDKCGNAY 41 >ref|XP_011095138.1| PREDICTED: B3 domain-containing transcription repressor VAL2 [Sesamum indicum] Length = 884 Score = 69.7 bits (169), Expect = 7e-10 Identities = 30/45 (66%), Positives = 34/45 (75%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M+ CMNG+C SS S+EW+KGWPLRSGGFATLC CGTAY Sbjct: 1 MEGGVCMNGMCA----SSNSLEWRKGWPLRSGGFATLCDNCGTAY 41 >gb|KDO64091.1| hypothetical protein CISIN_1g002708mg [Citrus sinensis] gi|641845204|gb|KDO64092.1| hypothetical protein CISIN_1g002708mg [Citrus sinensis] Length = 890 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M+SR CMNG C ASS SIEW+KGWPL+SGGFA LC KCG+A+ Sbjct: 1 MESRTCMNGKCRASS----SIEWRKGWPLQSGGFAVLCDKCGSAF 41 >gb|KDO64089.1| hypothetical protein CISIN_1g002708mg [Citrus sinensis] gi|641845202|gb|KDO64090.1| hypothetical protein CISIN_1g002708mg [Citrus sinensis] Length = 856 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M+SR CMNG C ASS SIEW+KGWPL+SGGFA LC KCG+A+ Sbjct: 1 MESRTCMNGKCRASS----SIEWRKGWPLQSGGFAVLCDKCGSAF 41 >ref|XP_006481192.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X4 [Citrus sinensis] Length = 856 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M+SR CMNG C ASS SIEW+KGWPL+SGGFA LC KCG+A+ Sbjct: 1 MESRTCMNGKCRASS----SIEWRKGWPLQSGGFAVLCDKCGSAF 41 >ref|XP_006429577.1| hypothetical protein CICLE_v10011039mg [Citrus clementina] gi|568855185|ref|XP_006481189.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X1 [Citrus sinensis] gi|568855187|ref|XP_006481190.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X2 [Citrus sinensis] gi|568855189|ref|XP_006481191.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X3 [Citrus sinensis] gi|557531634|gb|ESR42817.1| hypothetical protein CICLE_v10011039mg [Citrus clementina] Length = 890 Score = 69.7 bits (169), Expect = 7e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M+SR CMNG C ASS SIEW+KGWPL+SGGFA LC KCG+A+ Sbjct: 1 MESRTCMNGKCRASS----SIEWRKGWPLQSGGFAVLCDKCGSAF 41 >ref|XP_007033532.1| Transcription factor, putative isoform 3 [Theobroma cacao] gi|508712561|gb|EOY04458.1| Transcription factor, putative isoform 3 [Theobroma cacao] Length = 875 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M S++CMNG+CGAS TSIEW+KGW LRSG FA LC KCG+AY Sbjct: 1 MASKSCMNGLCGAS----TSIEWRKGWTLRSGDFANLCDKCGSAY 41 >ref|XP_007033531.1| High-level expression of sugar-inducible gene 2, putative isoform 2 [Theobroma cacao] gi|508712560|gb|EOY04457.1| High-level expression of sugar-inducible gene 2, putative isoform 2 [Theobroma cacao] Length = 911 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M S++CMNG+CGAS TSIEW+KGW LRSG FA LC KCG+AY Sbjct: 1 MASKSCMNGLCGAS----TSIEWRKGWTLRSGDFANLCDKCGSAY 41 >ref|XP_007033530.1| High-level expression of sugar-inducible gene 2, putative isoform 1 [Theobroma cacao] gi|508712559|gb|EOY04456.1| High-level expression of sugar-inducible gene 2, putative isoform 1 [Theobroma cacao] Length = 918 Score = 69.3 bits (168), Expect = 9e-10 Identities = 31/45 (68%), Positives = 36/45 (80%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M S++CMNG+CGAS TSIEW+KGW LRSG FA LC KCG+AY Sbjct: 1 MASKSCMNGLCGAS----TSIEWRKGWTLRSGDFANLCDKCGSAY 41 >ref|XP_012454319.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X3 [Gossypium raimondii] gi|763804594|gb|KJB71532.1| hypothetical protein B456_011G127500 [Gossypium raimondii] Length = 881 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M S++CMNG+CGA+ TSIEW+KGW LRSG FA LC KCG+AY Sbjct: 1 MASKSCMNGLCGAT----TSIEWRKGWALRSGDFANLCDKCGSAY 41 >ref|XP_012454315.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X1 [Gossypium raimondii] gi|823243327|ref|XP_012454316.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X1 [Gossypium raimondii] gi|823243329|ref|XP_012454317.1| PREDICTED: B3 domain-containing transcription repressor VAL2-like isoform X1 [Gossypium raimondii] gi|763804592|gb|KJB71530.1| hypothetical protein B456_011G127500 [Gossypium raimondii] gi|763804593|gb|KJB71531.1| hypothetical protein B456_011G127500 [Gossypium raimondii] Length = 917 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M S++CMNG+CGA+ TSIEW+KGW LRSG FA LC KCG+AY Sbjct: 1 MASKSCMNGLCGAT----TSIEWRKGWALRSGDFANLCDKCGSAY 41 >gb|KHG24632.1| B3 domain-containing transcription repressor VAL2 -like protein [Gossypium arboreum] Length = 917 Score = 68.2 bits (165), Expect = 2e-09 Identities = 30/45 (66%), Positives = 36/45 (80%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 M S++CMNG+CGA+ TSIEW+KGW LRSG FA LC KCG+AY Sbjct: 1 MASKSCMNGLCGAT----TSIEWRKGWALRSGDFANLCDKCGSAY 41 >gb|KJB20513.1| hypothetical protein B456_003G152700 [Gossypium raimondii] Length = 885 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/54 (62%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -1 Query: 161 NFPFSSL-QMDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 +F SSL M S+ CMN CGA+ TS EWKKGWPLRSGGFA LC CG+AY Sbjct: 12 DFDLSSLCWMGSKICMNSSCGAA----TSNEWKKGWPLRSGGFAHLCYPCGSAY 61 >ref|XP_011466419.1| PREDICTED: B3 domain-containing transcription repressor VAL2 isoform X2 [Fragaria vesca subsp. vesca] Length = 871 Score = 66.6 bits (161), Expect = 6e-09 Identities = 31/45 (68%), Positives = 33/45 (73%) Frame = -1 Query: 137 MDSRACMNGVCGASSFSSTSIEWKKGWPLRSGGFATLCAKCGTAY 3 MD ACMN CG+SS SIEWKKGW LRSG FA LC KCG+AY Sbjct: 1 MDPSACMNAYCGSSS----SIEWKKGWALRSGRFANLCHKCGSAY 41