BLASTX nr result
ID: Forsythia23_contig00026243
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00026243 (870 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009361332.1| PREDICTED: uncharacterized protein LOC103951... 66 3e-08 ref|XP_008376769.1| PREDICTED: vegetative incompatibility protei... 66 3e-08 ref|XP_008437636.1| PREDICTED: WD repeat-containing protein 44-l... 65 8e-08 ref|XP_008437633.1| PREDICTED: WD repeat-containing protein 44-l... 65 8e-08 ref|XP_011654594.1| PREDICTED: WD repeat-containing protein 44 i... 64 1e-07 ref|XP_011654596.1| PREDICTED: WD repeat-containing protein 44 i... 64 1e-07 ref|XP_008234700.1| PREDICTED: uncharacterized protein LOC103333... 64 1e-07 ref|XP_007220614.1| hypothetical protein PRUPE_ppa002072mg [Prun... 64 1e-07 ref|XP_010541487.1| PREDICTED: WD repeat-containing protein 44 [... 64 2e-07 ref|XP_002534336.1| WD-repeat protein, putative [Ricinus communi... 64 2e-07 ref|XP_010109232.1| WD repeat-containing protein 44 [Morus notab... 63 2e-07 ref|XP_012858392.1| PREDICTED: WD repeat-containing protein 44 i... 63 2e-07 ref|XP_012858391.1| PREDICTED: WD repeat-containing protein 44 i... 63 2e-07 ref|XP_012852119.1| PREDICTED: WD repeat-containing protein 44 [... 63 2e-07 gb|EYU19664.1| hypothetical protein MIMGU_mgv1a007057mg [Erythra... 63 2e-07 ref|XP_011044680.1| PREDICTED: WD repeat-containing protein 44 [... 63 3e-07 ref|XP_009351967.1| PREDICTED: uncharacterized protein LOC103943... 63 3e-07 ref|XP_008381066.1| PREDICTED: striatin homolog [Malus domestica... 63 3e-07 ref|XP_004309119.1| PREDICTED: WD repeat-containing protein 44-l... 63 3e-07 ref|XP_002271917.2| PREDICTED: WD repeat-containing protein YMR1... 62 4e-07 >ref|XP_009361332.1| PREDICTED: uncharacterized protein LOC103951627 [Pyrus x bretschneideri] Length = 718 Score = 66.2 bits (160), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPITV 776 S+SHAWG+VIVT GWDGRIRSFHNYGLP+TV Sbjct: 688 SSSHAWGMVIVTAGWDGRIRSFHNYGLPVTV 718 >ref|XP_008376769.1| PREDICTED: vegetative incompatibility protein HET-E-1-like [Malus domestica] Length = 723 Score = 66.2 bits (160), Expect = 3e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPITV 776 S+SHAWG+VIVT GWDGRIRSFHNYGLP+TV Sbjct: 693 SSSHAWGMVIVTAGWDGRIRSFHNYGLPVTV 723 >ref|XP_008437636.1| PREDICTED: WD repeat-containing protein 44-like isoform X2 [Cucumis melo] Length = 719 Score = 64.7 bits (156), Expect = 8e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPITV 776 S+SHAWGLVIVT GWDGRIRSFHNYGLP+ V Sbjct: 689 SSSHAWGLVIVTAGWDGRIRSFHNYGLPVPV 719 >ref|XP_008437633.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Cucumis melo] gi|659074491|ref|XP_008437634.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Cucumis melo] gi|659074493|ref|XP_008437635.1| PREDICTED: WD repeat-containing protein 44-like isoform X1 [Cucumis melo] Length = 759 Score = 64.7 bits (156), Expect = 8e-08 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPITV 776 S+SHAWGLVIVT GWDGRIRSFHNYGLP+ V Sbjct: 729 SSSHAWGLVIVTAGWDGRIRSFHNYGLPVPV 759 >ref|XP_011654594.1| PREDICTED: WD repeat-containing protein 44 isoform X1 [Cucumis sativus] gi|778698750|ref|XP_011654595.1| PREDICTED: WD repeat-containing protein 44 isoform X1 [Cucumis sativus] Length = 760 Score = 64.3 bits (155), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPITV 776 S+SHAWGLVIVT GWDGRIRSFHNYGLP+ + Sbjct: 730 SSSHAWGLVIVTAGWDGRIRSFHNYGLPVPI 760 >ref|XP_011654596.1| PREDICTED: WD repeat-containing protein 44 isoform X2 [Cucumis sativus] gi|700194663|gb|KGN49840.1| hypothetical protein Csa_5G139180 [Cucumis sativus] Length = 720 Score = 64.3 bits (155), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPITV 776 S+SHAWGLVIVT GWDGRIRSFHNYGLP+ + Sbjct: 690 SSSHAWGLVIVTAGWDGRIRSFHNYGLPVPI 720 >ref|XP_008234700.1| PREDICTED: uncharacterized protein LOC103333609 [Prunus mume] Length = 738 Score = 63.9 bits (154), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPITV 776 S+SHAWG+VIVT GWDGRIRSFHNYGLP+ V Sbjct: 708 SSSHAWGMVIVTAGWDGRIRSFHNYGLPVPV 738 >ref|XP_007220614.1| hypothetical protein PRUPE_ppa002072mg [Prunus persica] gi|462417076|gb|EMJ21813.1| hypothetical protein PRUPE_ppa002072mg [Prunus persica] Length = 720 Score = 63.9 bits (154), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPITV 776 S+SHAWG+VIVT GWDGRIRSFHNYGLP+ V Sbjct: 690 SSSHAWGMVIVTAGWDGRIRSFHNYGLPVPV 720 >ref|XP_010541487.1| PREDICTED: WD repeat-containing protein 44 [Tarenaya hassleriana] Length = 703 Score = 63.5 bits (153), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 865 TSHAWGLVIVTGGWDGRIRSFHNYGLPITV 776 +SH WGLVIVTGGWDGRIR FHNYGLP+TV Sbjct: 674 SSHLWGLVIVTGGWDGRIRLFHNYGLPVTV 703 >ref|XP_002534336.1| WD-repeat protein, putative [Ricinus communis] gi|223525468|gb|EEF28046.1| WD-repeat protein, putative [Ricinus communis] Length = 714 Score = 63.5 bits (153), Expect = 2e-07 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = -3 Query: 862 SHAWGLVIVTGGWDGRIRSFHNYGLPITV 776 SHAWGLVIVT GWDGRIRSFHNYGLP++V Sbjct: 686 SHAWGLVIVTAGWDGRIRSFHNYGLPVSV 714 >ref|XP_010109232.1| WD repeat-containing protein 44 [Morus notabilis] gi|587934494|gb|EXC21412.1| WD repeat-containing protein 44 [Morus notabilis] Length = 708 Score = 63.2 bits (152), Expect = 2e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 865 TSHAWGLVIVTGGWDGRIRSFHNYGLPI 782 TSHAWG+VIVT GWDGRIRSFHNYGLPI Sbjct: 679 TSHAWGMVIVTAGWDGRIRSFHNYGLPI 706 >ref|XP_012858392.1| PREDICTED: WD repeat-containing protein 44 isoform X2 [Erythranthe guttatus] Length = 661 Score = 63.2 bits (152), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPIT 779 S SHAWGLVIVT GWDGRIRSFHNYGLP++ Sbjct: 631 SDSHAWGLVIVTSGWDGRIRSFHNYGLPVS 660 >ref|XP_012858391.1| PREDICTED: WD repeat-containing protein 44 isoform X1 [Erythranthe guttatus] Length = 664 Score = 63.2 bits (152), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPIT 779 S SHAWGLVIVT GWDGRIRSFHNYGLP++ Sbjct: 634 SDSHAWGLVIVTSGWDGRIRSFHNYGLPVS 663 >ref|XP_012852119.1| PREDICTED: WD repeat-containing protein 44 [Erythranthe guttatus] gi|848905239|ref|XP_012852120.1| PREDICTED: WD repeat-containing protein 44 [Erythranthe guttatus] gi|604306199|gb|EYU25256.1| hypothetical protein MIMGU_mgv1a027154mg [Erythranthe guttata] Length = 679 Score = 63.2 bits (152), Expect = 2e-07 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPI 782 S SHAWGLVIVT GWDGRIRSFHNYGLP+ Sbjct: 649 SNSHAWGLVIVTAGWDGRIRSFHNYGLPV 677 >gb|EYU19664.1| hypothetical protein MIMGU_mgv1a007057mg [Erythranthe guttata] Length = 421 Score = 63.2 bits (152), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPIT 779 S SHAWGLVIVT GWDGRIRSFHNYGLP++ Sbjct: 391 SDSHAWGLVIVTSGWDGRIRSFHNYGLPVS 420 >ref|XP_011044680.1| PREDICTED: WD repeat-containing protein 44 [Populus euphratica] Length = 720 Score = 62.8 bits (151), Expect = 3e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPI 782 +TSHAWGLVIVT GWDGRI+SFHNYGLP+ Sbjct: 690 ATSHAWGLVIVTAGWDGRIKSFHNYGLPV 718 >ref|XP_009351967.1| PREDICTED: uncharacterized protein LOC103943394 [Pyrus x bretschneideri] gi|694321621|ref|XP_009351968.1| PREDICTED: uncharacterized protein LOC103943394 [Pyrus x bretschneideri] Length = 723 Score = 62.8 bits (151), Expect = 3e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPI 782 S+SHAWG+VIVT GWDGRIRSFHNYGLP+ Sbjct: 693 SSSHAWGMVIVTAGWDGRIRSFHNYGLPV 721 >ref|XP_008381066.1| PREDICTED: striatin homolog [Malus domestica] gi|657945691|ref|XP_008381071.1| PREDICTED: striatin homolog [Malus domestica] Length = 725 Score = 62.8 bits (151), Expect = 3e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPI 782 S+SHAWG+VIVT GWDGRIRSFHNYGLP+ Sbjct: 695 SSSHAWGMVIVTAGWDGRIRSFHNYGLPV 723 >ref|XP_004309119.1| PREDICTED: WD repeat-containing protein 44-like [Fragaria vesca subsp. vesca] Length = 709 Score = 62.8 bits (151), Expect = 3e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLPITV 776 S+SHAWG+VIVT GWDGRI+SFHNYGLP+ V Sbjct: 678 SSSHAWGMVIVTAGWDGRIKSFHNYGLPVPV 708 >ref|XP_002271917.2| PREDICTED: WD repeat-containing protein YMR102C [Vitis vinifera] Length = 732 Score = 62.4 bits (150), Expect = 4e-07 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -3 Query: 868 STSHAWGLVIVTGGWDGRIRSFHNYGLP 785 S+SHAWGLVIVT GWDGRIRSFHNYGLP Sbjct: 702 SSSHAWGLVIVTAGWDGRIRSFHNYGLP 729