BLASTX nr result
ID: Forsythia23_contig00026100
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00026100 (585 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082109.1| PREDICTED: cryptochrome DASH, chloroplastic/... 62 3e-07 >ref|XP_011082109.1| PREDICTED: cryptochrome DASH, chloroplastic/mitochondrial [Sesamum indicum] Length = 556 Score = 61.6 bits (148), Expect = 3e-07 Identities = 29/51 (56%), Positives = 36/51 (70%), Gaps = 4/51 (7%) Frame = -1 Query: 585 KRHFPGLLYIKPVVALKFGNTKIMNNKTVA----STADKNKWKGRKGNRTQ 445 KRHFPG+ YIKP++ALKFGNTK ++N+ A A + KW RKGNR Q Sbjct: 506 KRHFPGMSYIKPIMALKFGNTKPVSNRMTAPGNRRNATEEKWMSRKGNRFQ 556