BLASTX nr result
ID: Forsythia23_contig00026029
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00026029 (526 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011081658.1| PREDICTED: conserved oligomeric Golgi comple... 67 6e-09 ref|XP_012831380.1| PREDICTED: conserved oligomeric Golgi comple... 57 4e-06 gb|EYU46473.1| hypothetical protein MIMGU_mgv1a003974mg [Erythra... 57 4e-06 >ref|XP_011081658.1| PREDICTED: conserved oligomeric Golgi complex subunit 8 [Sesamum indicum] Length = 586 Score = 66.6 bits (161), Expect = 6e-09 Identities = 30/59 (50%), Positives = 40/59 (67%) Frame = -2 Query: 525 LPKQVHKLDTKSMSENGNLPVAENGVVHSDEQAASDNEKEKKQNNVSPQRRRSPVTNED 349 LPK VH + K+++ENGN P ENGV+H E+ AS + +EK+QNNVSPQ+ ED Sbjct: 521 LPKPVHNTEAKNVAENGNSPTVENGVLHGVERTASLSPEEKEQNNVSPQKEEKTTIRED 579 >ref|XP_012831380.1| PREDICTED: conserved oligomeric Golgi complex subunit 8-like [Erythranthe guttatus] Length = 588 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 2/62 (3%) Frame = -2 Query: 525 LPKQVHKLDTKSMSENG-NLPVAENGVVHSDEQAASDNEKEKKQNNV-SPQRRRSPVTNE 352 LPK + TK++ ENG N PV+ENGV H+ E+ AS N +EK+QNN+ SPQ+ T+E Sbjct: 520 LPKPALNVATKNVLENGGNQPVSENGVPHNIERTASANLEEKEQNNITSPQKEEQKATSE 579 Query: 351 DN 346 D+ Sbjct: 580 DD 581 >gb|EYU46473.1| hypothetical protein MIMGU_mgv1a003974mg [Erythranthe guttata] Length = 551 Score = 57.4 bits (137), Expect = 4e-06 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 2/62 (3%) Frame = -2 Query: 525 LPKQVHKLDTKSMSENG-NLPVAENGVVHSDEQAASDNEKEKKQNNV-SPQRRRSPVTNE 352 LPK + TK++ ENG N PV+ENGV H+ E+ AS N +EK+QNN+ SPQ+ T+E Sbjct: 483 LPKPALNVATKNVLENGGNQPVSENGVPHNIERTASANLEEKEQNNITSPQKEEQKATSE 542 Query: 351 DN 346 D+ Sbjct: 543 DD 544