BLASTX nr result
ID: Forsythia23_contig00025920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00025920 (364 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011093640.1| PREDICTED: 54S ribosomal protein L10, mitoch... 59 1e-06 >ref|XP_011093640.1| PREDICTED: 54S ribosomal protein L10, mitochondrial [Sesamum indicum] gi|747091795|ref|XP_011093641.1| PREDICTED: 54S ribosomal protein L10, mitochondrial [Sesamum indicum] Length = 282 Score = 59.3 bits (142), Expect = 1e-06 Identities = 33/64 (51%), Positives = 40/64 (62%) Frame = -1 Query: 244 QFPKPTSILPPRIFQETPLLQFVKCRLDLSNLSSYGCLGYQSRRAYSSLLALNDLRDNKG 65 Q+ KPTS PP + + F++CR D+S S + RAYSSLLALNDLRDN G Sbjct: 20 QYQKPTSSFPPFAGLQLDSVHFLQCRSDISKPSCQ----FGGLRAYSSLLALNDLRDNPG 75 Query: 64 ARKQ 53 ARKQ Sbjct: 76 ARKQ 79