BLASTX nr result
ID: Forsythia23_contig00025710
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00025710 (346 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009797325.1| PREDICTED: uncharacterized protein LOC104243... 66 1e-08 ref|XP_006361143.1| PREDICTED: uncharacterized protein LOC102592... 66 1e-08 ref|XP_009793425.1| PREDICTED: uncharacterized protein LOC104240... 65 2e-08 ref|XP_009605347.1| PREDICTED: uncharacterized protein LOC104099... 65 2e-08 emb|CDP09704.1| unnamed protein product [Coffea canephora] 64 5e-08 ref|XP_009626921.1| PREDICTED: uncharacterized protein LOC104117... 63 7e-08 ref|XP_011090212.1| PREDICTED: uncharacterized protein LOC105170... 62 2e-07 ref|XP_011080488.1| PREDICTED: uncharacterized protein LOC105163... 62 2e-07 ref|XP_003519500.1| PREDICTED: uncharacterized protein LOC100798... 59 1e-06 ref|XP_007015326.1| Ubiquitin-associated/translation elongation ... 59 1e-06 ref|XP_010093813.1| hypothetical protein L484_022526 [Morus nota... 58 2e-06 ref|XP_002523217.1| conserved hypothetical protein [Ricinus comm... 58 2e-06 ref|XP_004241382.1| PREDICTED: uncharacterized protein LOC101244... 58 2e-06 ref|XP_012851703.1| PREDICTED: uncharacterized protein LOC105971... 58 3e-06 gb|AET00142.2| ubiquitin-associated/TS-N domain protein, putativ... 58 3e-06 ref|XP_010031685.1| PREDICTED: uncharacterized protein LOC104421... 58 3e-06 ref|XP_012851647.1| PREDICTED: actin cytoskeleton-regulatory com... 58 3e-06 ref|XP_003617183.1| hypothetical protein MTR_5g088750 [Medicago ... 58 3e-06 ref|XP_012075995.1| PREDICTED: uncharacterized protein LOC105637... 57 4e-06 ref|XP_012463692.1| PREDICTED: uncharacterized protein LOC105783... 57 4e-06 >ref|XP_009797325.1| PREDICTED: uncharacterized protein LOC104243772 [Nicotiana sylvestris] Length = 659 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 ET+ GGSREWTSPFEEKDLFSLPRQFVSSPSL Sbjct: 628 ETSAGGSREWTSPFEEKDLFSLPRQFVSSPSL 659 >ref|XP_006361143.1| PREDICTED: uncharacterized protein LOC102592401 [Solanum tuberosum] Length = 659 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 ET+ GGSREWTSPFEEKDLFSLPRQFVSSPSL Sbjct: 628 ETSTGGSREWTSPFEEKDLFSLPRQFVSSPSL 659 >ref|XP_009793425.1| PREDICTED: uncharacterized protein LOC104240298 [Nicotiana sylvestris] Length = 659 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 ET+ GGSREWTSPFEE+DLFSLPRQFVSSPSL Sbjct: 628 ETSTGGSREWTSPFEERDLFSLPRQFVSSPSL 659 >ref|XP_009605347.1| PREDICTED: uncharacterized protein LOC104099920 [Nicotiana tomentosiformis] Length = 659 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 ET+ GGSREWTSPFEE+DLFSLPRQFVSSPSL Sbjct: 628 ETSTGGSREWTSPFEERDLFSLPRQFVSSPSL 659 >emb|CDP09704.1| unnamed protein product [Coffea canephora] Length = 668 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 ET+ GSREWTSPFEEKDLFSLPRQFVSSPSL Sbjct: 637 ETSTSGSREWTSPFEEKDLFSLPRQFVSSPSL 668 >ref|XP_009626921.1| PREDICTED: uncharacterized protein LOC104117555 [Nicotiana tomentosiformis] Length = 660 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 E++ GGSREWTSPFEE+DLFSLPRQFVSSPSL Sbjct: 629 ESSAGGSREWTSPFEERDLFSLPRQFVSSPSL 660 >ref|XP_011090212.1| PREDICTED: uncharacterized protein LOC105170953 [Sesamum indicum] Length = 653 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/28 (100%), Positives = 28/28 (100%) Frame = -1 Query: 334 GGSREWTSPFEEKDLFSLPRQFVSSPSL 251 GGSREWTSPFEEKDLFSLPRQFVSSPSL Sbjct: 626 GGSREWTSPFEEKDLFSLPRQFVSSPSL 653 >ref|XP_011080488.1| PREDICTED: uncharacterized protein LOC105163737 [Sesamum indicum] Length = 652 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 E GGSREWTSPFEE+DLFSLPRQFVSSPSL Sbjct: 621 EQPAGGSREWTSPFEERDLFSLPRQFVSSPSL 652 >ref|XP_003519500.1| PREDICTED: uncharacterized protein LOC100798094 [Glycine max] gi|734416534|gb|KHN38413.1| hypothetical protein glysoja_004078 [Glycine soja] Length = 650 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 ET+ GSREW+SPFE KDLFSLPRQFVSSPSL Sbjct: 619 ETSTAGSREWSSPFEGKDLFSLPRQFVSSPSL 650 >ref|XP_007015326.1| Ubiquitin-associated/translation elongation factor EF1B protein [Theobroma cacao] gi|508785689|gb|EOY32945.1| Ubiquitin-associated/translation elongation factor EF1B protein [Theobroma cacao] Length = 654 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 ET+ GS EWTSPFE KDLFSLPRQFVSSPSL Sbjct: 623 ETSTAGSHEWTSPFEGKDLFSLPRQFVSSPSL 654 >ref|XP_010093813.1| hypothetical protein L484_022526 [Morus notabilis] gi|587865085|gb|EXB54664.1| hypothetical protein L484_022526 [Morus notabilis] Length = 652 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 ET+ GSR+WTSPFE +DLFSLPRQFVSSPSL Sbjct: 621 ETSAAGSRDWTSPFEGEDLFSLPRQFVSSPSL 652 >ref|XP_002523217.1| conserved hypothetical protein [Ricinus communis] gi|223537513|gb|EEF39138.1| conserved hypothetical protein [Ricinus communis] Length = 663 Score = 58.2 bits (139), Expect = 2e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 ET+ GS EWTSPFE KDLFSLPRQFVSSPSL Sbjct: 632 ETSATGSHEWTSPFEGKDLFSLPRQFVSSPSL 663 >ref|XP_004241382.1| PREDICTED: uncharacterized protein LOC101244382 [Solanum lycopersicum] Length = 661 Score = 58.2 bits (139), Expect = 2e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 E + GGSREW SPFEE+DLFS PRQFVSSPSL Sbjct: 630 EASSGGSREWASPFEERDLFSAPRQFVSSPSL 661 >ref|XP_012851703.1| PREDICTED: uncharacterized protein LOC105971332 isoform X2 [Erythranthe guttatus] Length = 653 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 E GGSREWTS FEE+DLFSLPRQFVSSPSL Sbjct: 622 EPTGGGSREWTSAFEERDLFSLPRQFVSSPSL 653 >gb|AET00142.2| ubiquitin-associated/TS-N domain protein, putative [Medicago truncatula] Length = 663 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPS 254 ET+ GSREW+SPFE KDLFSLPRQFVSSPS Sbjct: 632 ETSAAGSREWSSPFEGKDLFSLPRQFVSSPS 662 >ref|XP_010031685.1| PREDICTED: uncharacterized protein LOC104421438 [Eucalyptus grandis] gi|629084691|gb|KCW51048.1| hypothetical protein EUGRSUZ_J00663 [Eucalyptus grandis] Length = 662 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 +T+ GSREWTSPFE KDLFSLPR+FVSSPSL Sbjct: 631 DTSAPGSREWTSPFEGKDLFSLPREFVSSPSL 662 >ref|XP_012851647.1| PREDICTED: actin cytoskeleton-regulatory complex protein PAN1 isoform X1 [Erythranthe guttatus] gi|604347994|gb|EYU46149.1| hypothetical protein MIMGU_mgv1a002108mg [Erythranthe guttata] Length = 713 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/32 (84%), Positives = 28/32 (87%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 E GGSREWTS FEE+DLFSLPRQFVSSPSL Sbjct: 682 EPTGGGSREWTSAFEERDLFSLPRQFVSSPSL 713 >ref|XP_003617183.1| hypothetical protein MTR_5g088750 [Medicago truncatula] Length = 669 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPS 254 ET+ GSREW+SPFE KDLFSLPRQFVSSPS Sbjct: 638 ETSAAGSREWSSPFEGKDLFSLPRQFVSSPS 668 >ref|XP_012075995.1| PREDICTED: uncharacterized protein LOC105637185 [Jatropha curcas] Length = 654 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 ET+ GS+EWTSPFE KDLFSLPRQFVSSPSL Sbjct: 623 ETSGTGSQEWTSPFEGKDLFSLPRQFVSSPSL 654 >ref|XP_012463692.1| PREDICTED: uncharacterized protein LOC105783056 [Gossypium raimondii] gi|763816736|gb|KJB83588.1| hypothetical protein B456_013G254200 [Gossypium raimondii] Length = 653 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -1 Query: 346 ETAVGGSREWTSPFEEKDLFSLPRQFVSSPSL 251 ET+ GS+EWTSPFE KDLFSLPRQ+VSSPS+ Sbjct: 622 ETSTAGSQEWTSPFEGKDLFSLPRQYVSSPSI 653