BLASTX nr result
ID: Forsythia23_contig00025542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00025542 (474 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089962.1| PREDICTED: DNA ligase 1-like [Sesamum indicum] 61 3e-07 >ref|XP_011089962.1| PREDICTED: DNA ligase 1-like [Sesamum indicum] Length = 841 Score = 60.8 bits (146), Expect = 3e-07 Identities = 39/79 (49%), Positives = 47/79 (59%) Frame = +2 Query: 236 MFSVLSCRHCWTFNTLSCNLTIKLSPNFSISFSRNHQKPFSSKLLFACPKQVFTFGTMST 415 MFS+ SC H +LS NL KL + S+SFS K F + + TMST Sbjct: 1 MFSLRSCSHRSVLVSLSLNLAGKLPFSPSVSFSL--------KPSFLFVSSIPSLRTMST 52 Query: 416 SRPSAFDVLMSNASKKKQN 472 SRPSAFD+LMSNASKKK+N Sbjct: 53 SRPSAFDILMSNASKKKKN 71