BLASTX nr result
ID: Forsythia23_contig00025510
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00025510 (521 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083644.1| PREDICTED: histone deacetylase complex subun... 56 8e-06 >ref|XP_011083644.1| PREDICTED: histone deacetylase complex subunit SAP18 [Sesamum indicum] Length = 157 Score = 56.2 bits (134), Expect = 8e-06 Identities = 31/40 (77%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Frame = -2 Query: 520 REVGRTFL----TGPDSGSKALSDLSFQIGDYLDVAILLQ 413 REVGRTF PDSGSKAL DLSFQIGDYLDVAIL Q Sbjct: 118 REVGRTFSYPNGRRPDSGSKALGDLSFQIGDYLDVAILTQ 157