BLASTX nr result
ID: Forsythia23_contig00025499
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia23_contig00025499 (477 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087416.1| PREDICTED: RNA polymerase I-specific transcr... 80 7e-13 ref|XP_012837320.1| PREDICTED: RNA polymerase I-specific transcr... 79 2e-12 gb|EYU37427.1| hypothetical protein MIMGU_mgv1a004171mg [Erythra... 79 2e-12 ref|XP_012470198.1| PREDICTED: RNA polymerase I-specific transcr... 65 2e-08 gb|KCW53303.1| hypothetical protein EUGRSUZ_J02557 [Eucalyptus g... 63 7e-08 ref|XP_010033606.1| PREDICTED: RNA polymerase I-specific transcr... 63 7e-08 gb|KCW53301.1| hypothetical protein EUGRSUZ_J02557 [Eucalyptus g... 63 7e-08 ref|XP_007204151.1| hypothetical protein PRUPE_ppa019726mg [Prun... 61 3e-07 ref|XP_002524432.1| transcription initiation factor ia, putative... 60 6e-07 ref|XP_009369775.1| PREDICTED: RNA polymerase I-specific transcr... 60 7e-07 ref|XP_008354575.1| PREDICTED: RNA polymerase I-specific transcr... 60 7e-07 ref|XP_008392869.1| PREDICTED: RNA polymerase I-specific transcr... 60 7e-07 gb|KDO67466.1| hypothetical protein CISIN_1g0074032mg, partial [... 59 1e-06 gb|KDO67298.1| hypothetical protein CISIN_1g0416052mg, partial [... 59 1e-06 ref|XP_006483734.1| PREDICTED: RNA polymerase I-specific transcr... 59 1e-06 ref|XP_006483560.1| PREDICTED: RNA polymerase I-specific transcr... 59 1e-06 ref|XP_006483559.1| PREDICTED: RNA polymerase I-specific transcr... 59 1e-06 ref|XP_006450295.1| hypothetical protein CICLE_v10010647mg [Citr... 59 1e-06 ref|XP_010088711.1| hypothetical protein L484_016497 [Morus nota... 58 3e-06 ref|XP_011022128.1| PREDICTED: RNA polymerase I-specific transcr... 58 3e-06 >ref|XP_011087416.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Sesamum indicum] Length = 626 Score = 79.7 bits (195), Expect = 7e-13 Identities = 38/49 (77%), Positives = 42/49 (85%) Frame = -1 Query: 477 GDAHLDEFDYALDKMSITPRDSSTKFGGRIQGFVQMPSKIRPSTSPESL 331 G + DEFD+ LDKMSITPRDSS KFGGR+Q F+QMPSKIRPS SPESL Sbjct: 578 GHSDADEFDHYLDKMSITPRDSSNKFGGRMQRFMQMPSKIRPSASPESL 626 >ref|XP_012837320.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Erythranthe guttatus] Length = 625 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 462 DEFDYALDKMSITPRDSSTKFGGRIQGFVQMPSKIRPSTSPESL 331 D FD +LDKMSITPRDSS KFGGR+Q FVQMPSKIRPSTSPESL Sbjct: 582 DAFDCSLDKMSITPRDSSAKFGGRMQRFVQMPSKIRPSTSPESL 625 >gb|EYU37427.1| hypothetical protein MIMGU_mgv1a004171mg [Erythranthe guttata] Length = 541 Score = 78.6 bits (192), Expect = 2e-12 Identities = 38/44 (86%), Positives = 40/44 (90%) Frame = -1 Query: 462 DEFDYALDKMSITPRDSSTKFGGRIQGFVQMPSKIRPSTSPESL 331 D FD +LDKMSITPRDSS KFGGR+Q FVQMPSKIRPSTSPESL Sbjct: 498 DAFDCSLDKMSITPRDSSAKFGGRMQRFVQMPSKIRPSTSPESL 541 >ref|XP_012470198.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Gossypium raimondii] gi|823140744|ref|XP_012470199.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Gossypium raimondii] gi|823140746|ref|XP_012470200.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Gossypium raimondii] gi|823140748|ref|XP_012470201.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Gossypium raimondii] gi|823140750|ref|XP_012470202.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Gossypium raimondii] gi|763751257|gb|KJB18645.1| hypothetical protein B456_003G064600 [Gossypium raimondii] gi|763751258|gb|KJB18646.1| hypothetical protein B456_003G064600 [Gossypium raimondii] Length = 629 Score = 65.1 bits (157), Expect = 2e-08 Identities = 33/46 (71%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -1 Query: 465 LDEFDYALDKMSITPRDSST-KFGGRIQGFVQMPSKIRPSTSPESL 331 +DEFDYAL KMSITP+ +S KFGGR Q +MPS+IRPSTSPESL Sbjct: 584 MDEFDYALKKMSITPKATSNYKFGGRFQEPARMPSRIRPSTSPESL 629 >gb|KCW53303.1| hypothetical protein EUGRSUZ_J02557 [Eucalyptus grandis] Length = 609 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/49 (63%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -1 Query: 474 DAHLDEFDYALDKMSITPRDSST-KFGGRIQGFVQMPSKIRPSTSPESL 331 D ++EFDYAL+KMSITP+ SS +FG + V+MPS+IRPSTSPESL Sbjct: 561 DIDMEEFDYALNKMSITPKQSSMYRFGSGLDELVRMPSRIRPSTSPESL 609 >ref|XP_010033606.1| PREDICTED: RNA polymerase I-specific transcription initiation factor rrn3 [Eucalyptus grandis] gi|629086945|gb|KCW53302.1| hypothetical protein EUGRSUZ_J02557 [Eucalyptus grandis] Length = 633 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/49 (63%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -1 Query: 474 DAHLDEFDYALDKMSITPRDSST-KFGGRIQGFVQMPSKIRPSTSPESL 331 D ++EFDYAL+KMSITP+ SS +FG + V+MPS+IRPSTSPESL Sbjct: 585 DIDMEEFDYALNKMSITPKQSSMYRFGSGLDELVRMPSRIRPSTSPESL 633 >gb|KCW53301.1| hypothetical protein EUGRSUZ_J02557 [Eucalyptus grandis] Length = 634 Score = 63.2 bits (152), Expect = 7e-08 Identities = 31/49 (63%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -1 Query: 474 DAHLDEFDYALDKMSITPRDSST-KFGGRIQGFVQMPSKIRPSTSPESL 331 D ++EFDYAL+KMSITP+ SS +FG + V+MPS+IRPSTSPESL Sbjct: 586 DIDMEEFDYALNKMSITPKQSSMYRFGSGLDELVRMPSRIRPSTSPESL 634 >ref|XP_007204151.1| hypothetical protein PRUPE_ppa019726mg [Prunus persica] gi|462399682|gb|EMJ05350.1| hypothetical protein PRUPE_ppa019726mg [Prunus persica] Length = 569 Score = 60.8 bits (146), Expect = 3e-07 Identities = 32/52 (61%), Positives = 41/52 (78%), Gaps = 3/52 (5%) Frame = -1 Query: 477 GDAHLD--EFDYALDKMSITPRDS-STKFGGRIQGFVQMPSKIRPSTSPESL 331 G+ H D EFD +L+KMSITP+DS ++FGG I ++MPS+IRPSTSPESL Sbjct: 518 GEQHFDFDEFDSSLNKMSITPKDSFHSRFGGAINQRMRMPSRIRPSTSPESL 569 >ref|XP_002524432.1| transcription initiation factor ia, putative [Ricinus communis] gi|223536316|gb|EEF37967.1| transcription initiation factor ia, putative [Ricinus communis] Length = 640 Score = 60.1 bits (144), Expect = 6e-07 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 465 LDEFDYALDKMSITPRDSSTKFGGRIQGFVQMPSKIRPSTSPESL 331 LDEFDYA++KMSITP++ +FG R +QMPSKIRPSTSPESL Sbjct: 599 LDEFDYAMNKMSITPKN---RFGIRFGERMQMPSKIRPSTSPESL 640 >ref|XP_009369775.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Pyrus x bretschneideri] Length = 627 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/46 (67%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -1 Query: 465 LDEFDYALDKMSITPRDS-STKFGGRIQGFVQMPSKIRPSTSPESL 331 LDEFD AL+KMSITP++S + FGG I+ ++MPS+IRPSTSPESL Sbjct: 582 LDEFDSALNKMSITPKNSLHSTFGGAIKQPMRMPSRIRPSTSPESL 627 >ref|XP_008354575.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Malus domestica] Length = 627 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/46 (67%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -1 Query: 465 LDEFDYALDKMSITPRDS-STKFGGRIQGFVQMPSKIRPSTSPESL 331 LDEFD AL+KMSITP++S + FGG I+ ++MPS+IRPSTSPESL Sbjct: 582 LDEFDSALNKMSITPKNSLHSTFGGAIKQPMRMPSRIRPSTSPESL 627 >ref|XP_008392869.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3 [Malus domestica] Length = 555 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/46 (67%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -1 Query: 465 LDEFDYALDKMSITPRDS-STKFGGRIQGFVQMPSKIRPSTSPESL 331 LDEFD AL+KMSITP++S + FGG I+ ++MPS+IRPSTSPESL Sbjct: 510 LDEFDSALNKMSITPKNSLHSTFGGAIKQPMRMPSRIRPSTSPESL 555 >gb|KDO67466.1| hypothetical protein CISIN_1g0074032mg, partial [Citrus sinensis] Length = 292 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/49 (59%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = -1 Query: 474 DAHLDEFDYALDKMSITPRDS-STKFGGRIQGFVQMPSKIRPSTSPESL 331 D LDEF+Y+L+KMSITP++S S + G ++ ++MPS+IRPSTSPESL Sbjct: 244 DLDLDEFEYSLNKMSITPKNSFSCRLDGELRQPMKMPSRIRPSTSPESL 292 >gb|KDO67298.1| hypothetical protein CISIN_1g0416052mg, partial [Citrus sinensis] Length = 292 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/49 (59%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = -1 Query: 474 DAHLDEFDYALDKMSITPRDS-STKFGGRIQGFVQMPSKIRPSTSPESL 331 D LDEF+Y+L+KMSITP++S S + G ++ ++MPS+IRPSTSPESL Sbjct: 244 DLDLDEFEYSLNKMSITPKNSFSCRLDGELRQPMKMPSRIRPSTSPESL 292 >ref|XP_006483734.1| PREDICTED: RNA polymerase I-specific transcription initiation factor RRN3-like [Citrus sinensis] Length = 315 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/49 (59%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = -1 Query: 474 DAHLDEFDYALDKMSITPRDS-STKFGGRIQGFVQMPSKIRPSTSPESL 331 D LDEF+Y+L+KMSITP++S S + G ++ ++MPS+IRPSTSPESL Sbjct: 267 DLDLDEFEYSLNKMSITPKNSFSCRLDGELRQPMKMPSRIRPSTSPESL 315 >ref|XP_006483560.1| PREDICTED: RNA polymerase I-specific transcription initiation factor rrn3-like isoform X2 [Citrus sinensis] Length = 535 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/49 (59%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = -1 Query: 474 DAHLDEFDYALDKMSITPRDS-STKFGGRIQGFVQMPSKIRPSTSPESL 331 D LDEF+Y+L+KMSITP++S S + G ++ ++MPS+IRPSTSPESL Sbjct: 487 DLDLDEFEYSLNKMSITPKNSFSCRLDGELRQPMKMPSRIRPSTSPESL 535 >ref|XP_006483559.1| PREDICTED: RNA polymerase I-specific transcription initiation factor rrn3-like isoform X1 [Citrus sinensis] Length = 628 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/49 (59%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = -1 Query: 474 DAHLDEFDYALDKMSITPRDS-STKFGGRIQGFVQMPSKIRPSTSPESL 331 D LDEF+Y+L+KMSITP++S S + G ++ ++MPS+IRPSTSPESL Sbjct: 580 DLDLDEFEYSLNKMSITPKNSFSCRLDGELRQPMKMPSRIRPSTSPESL 628 >ref|XP_006450295.1| hypothetical protein CICLE_v10010647mg [Citrus clementina] gi|557553521|gb|ESR63535.1| hypothetical protein CICLE_v10010647mg [Citrus clementina] Length = 87 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/49 (59%), Positives = 40/49 (81%), Gaps = 1/49 (2%) Frame = -1 Query: 474 DAHLDEFDYALDKMSITPRDS-STKFGGRIQGFVQMPSKIRPSTSPESL 331 D LDEF+Y+L+KMSITP++S S + G ++ ++MPS+IRPSTSPESL Sbjct: 39 DLDLDEFEYSLNKMSITPKNSFSCRLDGELRQPMKMPSRIRPSTSPESL 87 >ref|XP_010088711.1| hypothetical protein L484_016497 [Morus notabilis] gi|587846406|gb|EXB36892.1| hypothetical protein L484_016497 [Morus notabilis] Length = 616 Score = 57.8 bits (138), Expect = 3e-06 Identities = 29/49 (59%), Positives = 39/49 (79%), Gaps = 1/49 (2%) Frame = -1 Query: 474 DAHLDEFDYALDKMSITPRDS-STKFGGRIQGFVQMPSKIRPSTSPESL 331 D LDEFD A+++MSITP+DS +FG ++ ++MPS+IRPSTSPESL Sbjct: 568 DFDLDEFDSAMNQMSITPKDSLKHRFGAALKEPLRMPSRIRPSTSPESL 616 >ref|XP_011022128.1| PREDICTED: RNA polymerase I-specific transcription initiation factor rrn3 [Populus euphratica] Length = 637 Score = 57.8 bits (138), Expect = 3e-06 Identities = 31/49 (63%), Positives = 38/49 (77%), Gaps = 1/49 (2%) Frame = -1 Query: 474 DAHLDEFDYALDKMSITPRDSS-TKFGGRIQGFVQMPSKIRPSTSPESL 331 D LDEFDY ++KMSITP+++S FGG+ +MPSKIRPSTSPESL Sbjct: 594 DIDLDEFDYVMNKMSITPKNTSGFHFGGQ-----RMPSKIRPSTSPESL 637